Labshake search
Citations for Evrogen :
1 - 50 of 51 citations for PCR strip since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2023Quote: ... qRT-PCR was then performed with SYBR PCR Mix (Evrogen) using the Thermal Cycler system (Bio-Rad) ...
-
bioRxiv - Cancer Biology 2023Quote: ... PCR reactions were conducted in duplicate with the Encyclo Plus PCR kit (Evrogen, # PK101) on a T100 Thermal Cycler (Bio-Rad ...
-
bioRxiv - Immunology 2021Quote: Tersus Plus PCR Kit (Evrogen) was used for all amplification procedures ...
-
bioRxiv - Genomics 2020Quote: Encyclo PCR Kit (Evrogen, Russia) was used for the evaluation of the transposable element analysis ...
-
bioRxiv - Cancer Biology 2023Quote: ... OneTube RT-PCR SYBR kit (Evrogen) was used for cDNA production by reverse transcription followed by qPCR ...
-
bioRxiv - Plant Biology 2023Quote: ... The PCR reaction was conducted using a high-precision polymerase Tersus Plus PCR kit (Evrogen, Moscow, Russia) with the following primers ...
-
bioRxiv - Biochemistry 2022Quote: An expression vector for the C-terminal 6×His-tagged ARD protein was constructed by amplifying the ard gene (GenBank Gene ID: 57822953) by PCR with a high fidelity Tersus PCR kit (Evrogen) and the primer pair 5’-GAGGAATAAATTTATGGCTCAGTTAGTCGAT / 5’-GGAAACAAGATCAGATGCACTCTC using the genomic DNA of V ...
-
bioRxiv - Cell Biology 2022Quote: ... the PCR product and vector pTurboGFP-N (Evrogen) were digested with XhoI and HindIII purified and ligated to generate pGADD34-TurboGFP ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Using the Tersus Plus PCR kit (Evrogen, PK221), blunting of the protruding ends in combination with A-tail treatment was performed ...
-
bioRxiv - Molecular Biology 2020Quote: ... RT-PCR was performed with Taq polymerase (Evrogen, Russia) or Phusion High-Fidelity DNA polymerase (ThermoFisher ...
-
bioRxiv - Cancer Biology 2019Quote: ... PCR was performed with Taq polymerase (PK113S, Evrogen, Russia) or Phusion High-Fidelity DNA polymerase (F530S ...
-
bioRxiv - Molecular Biology 2021Quote: ... PCRs were done with Encyclo DNA polymerase (Evrogen, Moscow) and the AR9 genomic DNA as a template ...
-
bioRxiv - Microbiology 2019Quote: ... Quantitative PCR was performed using qPCRmix-HS SYBR (Evrogen, Russia) and the Light Cycler 480 real-time PCR system (Roche ...
-
bioRxiv - Molecular Biology 2021Quote: ... smegmatis genomic DNA by using Tersus Plus PCR kit (Evrogen) with primers (−47 ...
-
bioRxiv - Neuroscience 2020Quote: ... following PCR amplification from a pCMV-mito-KillerRed plasmid (Evrogen). mScarlet-i cDNA was amplified by PCR from a pmScarlet-i_C1 plasmid (gift from Dorus Gadella ...
-
bioRxiv - Bioengineering 2019Quote: DNA amplification was performed using the Encyclo PCR Kit (Evrogen) on a PTC-200 Thermal Cycler (MJ Research) ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplification was performed using EncycloPlus PCR kit (Evrogen, Moscow, Russia) using the following program ...
-
bioRxiv - Molecular Biology 2020Quote: ... PCR product was cloned to t-vector (pAL2-T, Evrogen, Russia) and sequenced by Sanger for at least 10 clones for each point.
-
bioRxiv - Molecular Biology 2021Quote: ... a set of PCR reagents Master-mix ScreenMix HS (Evrogen, Russia), 5xMasCFGTaqMIX-2025 (unstained ...
-
bioRxiv - Microbiology 2020Quote: ... The fragment encoding tagRFP was PCR-amplified from pTagRFP-N (Evrogen). The fragments of ftsZ ...
-
bioRxiv - Molecular Biology 2021Quote: ... All amplification reactions were done with the Tersus Plus PCR kit (Evrogen).
-
bioRxiv - Immunology 2021Quote: ... For quantitative PCR samples from adipose tissue were homogenized in ExtractRNA (Evrogen) which is Trizol analog ...
-
bioRxiv - Synthetic Biology 2024Quote: ... The PCR product was extracted using the Cleanup Standard kit (Evrogen, BC022S), and then treated with T4 polynucleotide kinase (Thermo Scientific ...
-
bioRxiv - Molecular Biology 2023Quote: ... PCR fragments were gel-extracted using the Cleanup Standard kit (Evrogen, BC04) and sequenced using were sequenced using NovaSeq 6000 with 300 paired-end cycles.
-
bioRxiv - Evolutionary Biology 2022Quote: ... PCR was performed in 15 μl reaction mixture of Screen Mix (Evrogen, Russia) in a Veriti Thermal Cycler (Applied Biosystems ...
-
bioRxiv - Molecular Biology 2023Quote: ... The PCR fragments were gel-extracted using the Cleanup Standard kit (Evrogen, BC04) and sequenced using Illumina NextSeq ...
-
bioRxiv - Plant Biology 2021Quote: ... The cDNA for qRT-PCR was synthesized using an MMLV RT Kit (Evrogen, Russia) according to the manufacturer’s recommendations employing oligo(dT)17 -primers from 2 μg total RNA after DNase treatment ...
-
bioRxiv - Immunology 2023Quote: ... Capillary sequences of the target PCR products were obtained as a service (Evrogen, Russia).
-
bioRxiv - Molecular Biology 2023Quote: ... The PCR fragments were gel-extracted using a Cleanup S-Cap kit (Evrogen, BC04). Next ...
-
bioRxiv - Cell Biology 2020Quote: ... we PCR amplified the coding region of the far-red fluores-cent protein turboFP635 (Evrogen) using primer sequences 5’-TGTACCGGTCTCGAGGCCACCAT-GGTGGGTGAGG and 5’-AGATCCGGAGCTGTG-CCCCAGTTTGCTA ...
-
bioRxiv - Molecular Biology 2021Quote: The following primers and a probe were used for real-time PCR (synthesis at Evrogen, Russia):
-
bioRxiv - Neuroscience 2023Quote: ... Quantitative real time RT–PCR was performed using Evrogen 5x qPCR mix-HS SYBR (Evrogen, #PK147L). Primers (Table 2 ...
-
bioRxiv - Neuroscience 2019Quote: ... the mRit2 coding region was PCR-amplified and subcloned in-frame into the pTagRFP-C vector (Evrogen) at HindIII/XbaI sites ...
-
bioRxiv - Molecular Biology 2020Quote: ... DNA bands were excised with subsequent purification of PCR products using a Cleanup Standard Kit (Evrogen, BC022). Restriction enzymes ...
-
bioRxiv - Cell Biology 2021Quote: ... for reverse transcription (MMLV RT kit) and for real time PCR (HS SYBR kit) were obtained from Evrogen, Russia ...
-
bioRxiv - Cell Biology 2022Quote: ... EB1-TagRFP was generated by PCR amplification from KAZUSA cDNA (NCBI AB463888) and inserted into pTagRFP-N (Evrogen). The shRNA target sequence was designed for protein knockdown using the BLOCK-iT RNAi Designer tool (Thermo Fisher Scientific) ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... For polymer chain reactions we used Evrogen PCR kits with Hot Start thermostable polymerase (HS Taq polymerase, Evrogen, Russia). PCR reactions were carried out for each locus separately in a total volume of 14.1 μl (0.2 μl of a primer mixture containing forward and reverse primers ...
-
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinitiesbioRxiv - Biochemistry 2019Quote: ... The coding sequence for Tag-RFP was subsequently introduced in the EcoRI site through PCR from pTag_RFP-Actin (Evrogen), using the primers primSB_0003 and 0004 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The relative abundance of transcripts was estimated using quantitative real-time PCR with Hot Start DNA polymerase (Evrogen, Russia) and SYTO@ 13 green fluorescent nucleic acid stain (Life Technologies ...
-
bioRxiv - Cell Biology 2021Quote: ... and 5’-ccgggggcggccgctcaaagcttacttttgttcatatgtttattcaatgca-3’ (for pMF1992)) and subcloning the BamHI/NotI-restricted PCR products into the BamHI/NotI-restricted backbone fragments of pKillerRed-dMito (Evrogen) (for pMF1991 ...
-
bioRxiv - Microbiology 2020Quote: The plasmid expressing phoP and phoQ was constructed by cloning the PCR fragment amplified with the Tersus DNA polymerase (Evrogen) and the phoPQf1 and phoPQr primers into the low copy number vector pZH449.
-
bioRxiv - Evolutionary Biology 2020Quote: ... the number of molecules in each library was validated by real-time PCR using 2.5x Reaction mixture for PCR-RV in the presence of EVA Green (SINTOL, Russia) and primers for Illumina adapters (Evrogen, Russia). Further ...
-
Molecular coevolution of nuclear and nucleolar localization signals inside basic domain of HIV-1 TatbioRxiv - Evolutionary Biology 2021Quote: ... The amplified PCR product was digested with EcoRI and BamHI and then inserted into the pTagRFP-N1 vector (Evrogen, Moscow, Russia). After cloning into an expression vector ...
-
bioRxiv - Plant Biology 2020Quote: Amplification of TALE genes was performed via a two-step PCR process in conjunction with primers 5’-GATCCCATTCGTTCGCGCACACCAAGTC-3’ and 5’-CTCCATCAACCATGCGAGCTCCTCTTCG-3’ and Taq DNA polymerase (Evrogen, Russia) under the following conditions ...
-
bioRxiv - Microbiology 2020Quote: ... The quantitative RT-PCR experiments were performed in triplicates on two independently grown colonies for each isolate in the sample with the use of OneTube RT-PCR SYBR Kit (Evrogen, Russia). The reactions were carried out on CFX96 Touch Real-Time PCR Detection System (Bio-Rad ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2021Quote: ... a DNA fragment containing the hepatitis A virus 3C protease (3Cpro) gene with EcoRI and KpnI sites was generated by PCR using the primers GACTGAATTCGCCACCATGTCAACTCTAGAAATAGCAGG and CAACGGTACCTTACTGACTTTCAATTTTCTTATCAATG (Evrogen, Russia), and pBI-EGFP-3C [11] as the template ...
-
bioRxiv - Molecular Biology 2023Quote: ... 700 ng of PCR product was taken per one 100µl aliquot of E.coli XL1-Blue competent cells (Evrogen, Moscow, Russian Federation).
-
bioRxiv - Biochemistry 2020Quote: ... The DNA fragment encoding the RBDv1 ORF with Kozak consensus sequence and C-terminal c-myc and 6xHis tags were obtained by PCR using primers AD-COV-AbsF and AD-RBD-myc6HNheR (listed in Table 1) and Tersus polymerase mix (Evrogen, Moscow, Russia). Synthetic oligo’s ...