Labshake search
Citations for Evrogen :
51 - 56 of 56 citations for PCR Master Mix since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2020Quote: ... The quantitative RT-PCR experiments were performed in triplicates on two independently grown colonies for each isolate in the sample with the use of OneTube RT-PCR SYBR Kit (Evrogen, Russia). The reactions were carried out on CFX96 Touch Real-Time PCR Detection System (Bio-Rad ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2021Quote: ... a DNA fragment containing the hepatitis A virus 3C protease (3Cpro) gene with EcoRI and KpnI sites was generated by PCR using the primers GACTGAATTCGCCACCATGTCAACTCTAGAAATAGCAGG and CAACGGTACCTTACTGACTTTCAATTTTCTTATCAATG (Evrogen, Russia), and pBI-EGFP-3C [11] as the template ...
-
bioRxiv - Molecular Biology 2023Quote: ... 700 ng of PCR product was taken per one 100µl aliquot of E.coli XL1-Blue competent cells (Evrogen, Moscow, Russian Federation).
-
bioRxiv - Molecular Biology 2023Quote: ... into enhanced Piggybac (ePB) doxycycline-inducible expression vectors.46 Overlap PCR constructs encoding FLAG-APEX2 fusions with mKate2 fluorescent protein (Evrogen, cat. #FP181) were cloned between BamHI and NotI sites in ePB vectors as follows ...