Labshake search
Citations for Evrogen :
1 - 50 of 144 citations for Mouse T cell receptor alpha chain C region TCRA ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: gDNA for T and CD45Δ T cells was obtained with an ExtractDNA Blood & Cells Kit (Evrogen, Russia) on the 2nd day after knockout ...
-
bioRxiv - Neuroscience 2019Quote: ... the mRit2 coding region was PCR-amplified and subcloned in-frame into the pTagRFP-C vector (Evrogen) at HindIII/XbaI sites ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... For polymer chain reactions we used Evrogen PCR kits with Hot Start thermostable polymerase (HS Taq polymerase, Evrogen, Russia). PCR reactions were carried out for each locus separately in a total volume of 14.1 μl (0.2 μl of a primer mixture containing forward and reverse primers ...
-
bioRxiv - Molecular Biology 2020Quote: ... PCR product was cloned to t-vector (pAL2-T, Evrogen, Russia) and sequenced by Sanger for at least 10 clones for each point.
-
bioRxiv - Cell Biology 2020Quote: ... we PCR amplified the coding region of the far-red fluores-cent protein turboFP635 (Evrogen) using primer sequences 5’-TGTACCGGTCTCGAGGCCACCAT-GGTGGGTGAGG and 5’-AGATCCGGAGCTGTG-CCCCAGTTTGCTA ...
-
bioRxiv - Synthetic Biology 2024Quote: ... was inserted into the pAL2-T vector (Evrogen, TA002). Using the Tersus Plus PCR kit (Evrogen ...
-
bioRxiv - Biochemistry 2020Quote: ... Obtained DNA was purified and cloned into pKAN-T (Evrogen) vector that was subsequently sequenced ...
-
bioRxiv - Biochemistry 2024Quote: ... woodyi cells using an RNA Solo kit (Evrogen) and additionally digested with RNase-free DNase I (Thermo Scientific ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2021Quote: ... pDendra2-C vector (Evrogen) was modified ...
-
bioRxiv - Cell Biology 2019Quote: ... pTagGFP2-C (FP191, Evrogen) and pcDNA3.1 mycBioID (gift from Kyle Roux (Roux et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... and pTagRFP-C (Evrogen) as above ...
-
bioRxiv - Biochemistry 2020Quote: pTagBFP-C (Evrogen, Moscow, RU) was used to generate the expression constructs of Rab5 and EHD2 wt or I157Q ...
-
bioRxiv - Cell Biology 2022Quote: ... pTagRFP-C (#FP141) from Evrogen, fura-2-AM ...
-
bioRxiv - Cell Biology 2024Quote: ... or pKatushka2S-C (Evrogen, FP761) vectors using BglII/BamHI restriction/ligation.
-
bioRxiv - Cell Biology 2024Quote: ... or pKatushka2S-C (Evrogen, FP761) vectors using BglII/BamHI restriction/ligation.
-
bioRxiv - Cancer Biology 2023Quote: RNA was extracted from cultured cells using the ExtractRNA kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2020Quote: ... mIBP83 fragment of pEX-A2-SBP-T plasmid was subcloned into pTagGFP2-N vector (Evrogen) by PCR with the primers
-
bioRxiv - Microbiology 2020Quote: ... The fixed cells were harvested (8000 g, 5 min, 4 °C) and resuspended in 1 mL of ExtractRNA Reagent (Evrogen, Russia) and the subsequent procedures were performed according to manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Microbiology 2022Quote: ... 200 ng of plasmid pTagRFP-C (Evrogen), which expresses TagRFP from a CMV promoter ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Immunology 2021Quote: Phagemid DNA was isolated from bacterial cells using the Plasmid miniprep kit (Evrogen, Russia). VHH-coding sequences were sequenced with Lac-prom (5’-CTTTATGCTTCCGGCTCGTATG-3’ ...
-
bioRxiv - Cell Biology 2022Quote: ... and inserted into the pTagBFP-C (Evrogen, Moscow, RU) expression vector.
-
bioRxiv - Cell Biology 2022Quote: ... Mouse anti-Aub antibody (1:20) (Patil and Kai 2010) or mouse anti-mKate2 (Evrogen, 1:200) was added to the cleared lysate and incubated at 4°C for 2 h with rotation ...
-
bioRxiv - Biochemistry 2020Quote: ... plasmid # 162785 Plasmids for cell transfections were purified by the Plasmid Midiprep kit (Evrogen, Moscow, Russia) and concentrated by ethanol precipitation in sterile conditions.
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Genetics 2022Quote: ... The 750 bp TagYFP coding sequence was amplified from pTagYFP-C (Evrogen) using primer pairs P3-TagYFP F1 and TagYFP 3R1:
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pFusionRed-C vector (Evrogen, FP411). The Cry2 fragment was amplified by PCR from the plasmid pHR-mCh-Cry2WT (Addgene ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into either the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the FusionRed-C vector (Evrogen, FP411) linearized with XhoI ...
-
bioRxiv - Cell Biology 2022Quote: ... and incubated with the antibody (mouse anti-GFP [Thermos Fisher Scientific, 3E6, 1:500] or mouse anti-mKate2 [Evrogen, AB233, 1:500]) overnight at 4°C ...
-
bioRxiv - Cell Biology 2022Quote: ... TagRFP-FYVE(EE1A) was subcloned from pRS424GFP-FYVE(EEA1) into pTagRFP-C (Evrogen) and pEGFP-C1 (Clontech ...
-
bioRxiv - Molecular Biology 2023Quote: ... All cell lines were repeatedly tested for the presence of mycoplasma contamination with a MycoReport Mycoplasma Detection Kit (Evrogen, Russia).
-
bioRxiv - Cancer Biology 2019Quote: ... Expression constructs were created on the basis of vectors: pTagGFP2-C (#FF191, Evrogen, Russia). Sequencing was performed by the Sanger’s method (Evrogen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... DNA fragments encoding M9M and Bimax2 peptides were inserted into the pTagRFP-C vector (Evrogen).
-
bioRxiv - Immunology 2021Quote: ... ScreenMix Kit (Evrogen) was used according to the manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2020Quote: ... (ii) the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA ...
-
bioRxiv - Cell Biology 2023Quote: ... and anti-Tag(CGY)FP (1:2000 in 0.5% milk TBST, 4°C o/n, Evrogen AB121). Blots were then incubated with IRDye 800/680 conjugated antibodies (1:10000 in 5% milk TBST ...
-
bioRxiv - Pathology 2020Quote: ... Quick-TA kit (Evrogen JSC) was used for cloning ...
-
bioRxiv - Immunology 2021Quote: Tersus Plus PCR Kit (Evrogen) was used for all amplification procedures ...
-
bioRxiv - Genomics 2020Quote: Encyclo PCR Kit (Evrogen, Russia) was used for the evaluation of the transposable element analysis ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Cancer Biology 2023Quote: ... OneTube RT-PCR SYBR kit (Evrogen) was used for cDNA production by reverse transcription followed by qPCR ...
-
bioRxiv - Biochemistry 2020Quote: HT1080 cells were plated in wells of Lab-Tek II chamber and co-transfected with pTwist-EF1a-nCoV-2019-S-2xStrep and pTagGFP2-C (Evrogen) plasmids ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Genomics 2020Quote: ... with cDNAs were incubated at 68 °C for 2 minutes before adding pre-warmed DSN buffer mix with 1 Units of DSN enzyme (Evrogen). The reaction then performed at 68 °C for 20 minutes ...
-
bioRxiv - Physiology 2023Quote: ... with 1% beta-mercaptoethanol in a 1.5-ml tube using a polypropylene pestle and a drill and then incubated (55 °C, 10 min) with protein kinase K (Evrogen, Russia). Total RNA was extracted by a silica spin column (CleanRNA Standard ...
-
bioRxiv - Cell Biology 2021Quote: ... for reverse transcription (MMLV RT kit) and for real time PCR (HS SYBR kit) were obtained from Evrogen, Russia ...
-
bioRxiv - Cell Biology 2020Quote: Cells were maintained in anti-bleaching live cell visualization medium (DMEMgfp; Evrogen), supplemented with 10% fetal bovine serum at 37°C in 5% CO2 ...