Labshake search
Citations for Evrogen :
1 - 50 of 55 citations for MBL 2 MBP C Human HEK293 His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2024Quote: ... and rabbit monoclonal antibodies to GFP (598; MBL) and TagRFP (AB233; Evrogen). Rabbit polyclonal antibodies to US11 were described previously 41 ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Genomics 2020Quote: ... with cDNAs were incubated at 68 °C for 2 minutes before adding pre-warmed DSN buffer mix with 1 Units of DSN enzyme (Evrogen). The reaction then performed at 68 °C for 20 minutes ...
-
bioRxiv - Cell Biology 2021Quote: ... pDendra2-C vector (Evrogen) was modified ...
-
bioRxiv - Cell Biology 2019Quote: ... pTagGFP2-C (FP191, Evrogen) and pcDNA3.1 mycBioID (gift from Kyle Roux (Roux et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... and pTagRFP-C (Evrogen) as above ...
-
bioRxiv - Biochemistry 2020Quote: pTagBFP-C (Evrogen, Moscow, RU) was used to generate the expression constructs of Rab5 and EHD2 wt or I157Q ...
-
bioRxiv - Cell Biology 2022Quote: ... pTagRFP-C (#FP141) from Evrogen, fura-2-AM ...
-
bioRxiv - Cell Biology 2024Quote: ... or pKatushka2S-C (Evrogen, FP761) vectors using BglII/BamHI restriction/ligation.
-
bioRxiv - Cell Biology 2024Quote: ... or pKatushka2S-C (Evrogen, FP761) vectors using BglII/BamHI restriction/ligation.
-
bioRxiv - Microbiology 2022Quote: ... 200 ng of plasmid pTagRFP-C (Evrogen), which expresses TagRFP from a CMV promoter ...
-
bioRxiv - Cell Biology 2022Quote: ... and inserted into the pTagBFP-C (Evrogen, Moscow, RU) expression vector.
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Microbiology 2021Quote: ... 2 μl 10x Taq Turbo buffer (Evrogen), 0.25 mM dNTPs ...
-
bioRxiv - Genetics 2022Quote: ... The 750 bp TagYFP coding sequence was amplified from pTagYFP-C (Evrogen) using primer pairs P3-TagYFP F1 and TagYFP 3R1:
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the pFusionRed-C vector (Evrogen, FP411). The Cry2 fragment was amplified by PCR from the plasmid pHR-mCh-Cry2WT (Addgene ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into either the pTurboGFP-C (Evrogen, FP511) or pKatushka2S-C (Evrogen ...
-
bioRxiv - Cell Biology 2024Quote: ... The amplified fragment was inserted into the FusionRed-C vector (Evrogen, FP411) linearized with XhoI ...
-
bioRxiv - Cell Biology 2022Quote: ... TagRFP-FYVE(EE1A) was subcloned from pRS424GFP-FYVE(EEA1) into pTagRFP-C (Evrogen) and pEGFP-C1 (Clontech ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Cancer Biology 2019Quote: ... Expression constructs were created on the basis of vectors: pTagGFP2-C (#FF191, Evrogen, Russia). Sequencing was performed by the Sanger’s method (Evrogen ...
-
bioRxiv - Biophysics 2019Quote: Monomeric photoswitchable cyan fluorescence protein 2 (PS-CFP2, Evrogen) was C-terminally equipped with an AVI-tag (GLNDIFEAQKIEWHE ...
-
bioRxiv - Immunology 2023Quote: Monomeric photoswitchable cyan fluorescence protein 2 (PS-CFP2, Evrogen) featuring an unpaired cysteine residue and C-terminally extended with an AVI-tag (GLNDIFEAQKIEWHE ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... DNA fragments encoding M9M and Bimax2 peptides were inserted into the pTagRFP-C vector (Evrogen).
-
bioRxiv - Genomics 2020Quote: ... was performed using the Trimmer-2 cDNA normalisation kit (Evrogen) following the manufacturer’s instructions ...
-
bioRxiv - Genomics 2023Quote: ... 2: rabbit anti-tRFP (1:1,000 dilution, polyclonal, Evrogen, AB233). The following secondary antibodies were used ...
-
bioRxiv - Cell Biology 2019Quote: ... or DMEMEGFP-2 anti-bleaching live cell visualization medium (Evrogen, #MCK02), both supplemented with 10% FBS and GlutaMAX-I (Gibco ...
-
bioRxiv - Cell Biology 2023Quote: ... medium was replaced with live-cell visualization medium DMEMgfp-2 (Evrogen) supplemented with 10 % FBS ...
-
bioRxiv - Neuroscience 2019Quote: ... the mRit2 coding region was PCR-amplified and subcloned in-frame into the pTagRFP-C vector (Evrogen) at HindIII/XbaI sites ...
-
bioRxiv - Neuroscience 2020Quote: ... (ii) the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA ...
-
bioRxiv - Cell Biology 2023Quote: ... and anti-Tag(CGY)FP (1:2000 in 0.5% milk TBST, 4°C o/n, Evrogen AB121). Blots were then incubated with IRDye 800/680 conjugated antibodies (1:10000 in 5% milk TBST ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2021Quote: ... the medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen) supplemented with 10% FBS and 2 mM L- glutamine ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Immunology 2021Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Immunology 2023Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Cell Biology 2019Quote: ... Media was exchanged to DMEMGFP-2 anti-bleaching live cell visualization medium (Evrogen # MCK02) supplemented with 10% FBS and GlutaMAX (Gibco #35050061 ...
-
bioRxiv - Molecular Biology 2021Quote: ... the resulting product was cleaned from 2% agarose gel by Cleanup Standard Kit (Evrogen), digested by MluI and HindIII and ligated into pMV306/MluI ...
-
bioRxiv - Cell Biology 2019Quote: ... Cells were imaged in DMEM gfp-2 anti-bleaching live-cell imaging medium (Evrogen) supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Biochemistry 2020Quote: HT1080 cells were plated in wells of Lab-Tek II chamber and co-transfected with pTwist-EF1a-nCoV-2019-S-2xStrep and pTagGFP2-C (Evrogen) plasmids ...
-
bioRxiv - Microbiology 2020Quote: ... The fixed cells were harvested (8000 g, 5 min, 4 °C) and resuspended in 1 mL of ExtractRNA Reagent (Evrogen, Russia) and the subsequent procedures were performed according to manufacturer’s instructions ...
-
bioRxiv - Physiology 2023Quote: ... with 1% beta-mercaptoethanol in a 1.5-ml tube using a polypropylene pestle and a drill and then incubated (55 °C, 10 min) with protein kinase K (Evrogen, Russia). Total RNA was extracted by a silica spin column (CleanRNA Standard ...
-
bioRxiv - Systems Biology 2019Quote: ... Tissue-specific cDNA libraries were created using the Mint-2 cDNA Synthesis Kit (Evrogen, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Cancer Biology 2023Quote: ... cDNA was generated from total RNA (2 μg) by using MMLV reverse transcriptase (Evrogen, Russia). Reverse transcription PCR reaction conditions were as follows ...
-
bioRxiv - Genomics 2023Quote: ... 100 ng of amplified products was mixed with 2 μL of 10X DSN buffer (Evrogen) and H2O to 20 μL ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2 μg of total RNA and a reaction mixture with MMLV reverse transcriptase (Evrogen, Russia) were used ...
-
bioRxiv - Cell Biology 2021Quote: ... Blots were incubated overnight at 4°C with primary antibodies targeting Tag(CGY)FP (1:2000 dilution in 1% milk, Evrogen, Cat#: AB121), HaloTag (1:1000 dilution in 0.5% milk ...