Labshake search
Citations for Evrogen :
1 - 50 of 121 citations for Human Nuclear Factor Of Activated T Cells 5 NFAT5 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: gDNA for T and CD45Δ T cells was obtained with an ExtractDNA Blood & Cells Kit (Evrogen, Russia) on the 2nd day after knockout ...
-
bioRxiv - Molecular Biology 2020Quote: ... PCR product was cloned to t-vector (pAL2-T, Evrogen, Russia) and sequenced by Sanger for at least 10 clones for each point.
-
bioRxiv - Synthetic Biology 2024Quote: ... was inserted into the pAL2-T vector (Evrogen, TA002). Using the Tersus Plus PCR kit (Evrogen ...
-
bioRxiv - Biochemistry 2020Quote: ... Obtained DNA was purified and cloned into pKAN-T (Evrogen) vector that was subsequently sequenced ...
-
bioRxiv - Biochemistry 2024Quote: ... woodyi cells using an RNA Solo kit (Evrogen) and additionally digested with RNase-free DNase I (Thermo Scientific ...
-
bioRxiv - Cancer Biology 2023Quote: RNA was extracted from cultured cells using the ExtractRNA kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2020Quote: ... mIBP83 fragment of pEX-A2-SBP-T plasmid was subcloned into pTagGFP2-N vector (Evrogen) by PCR with the primers
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
Wolf-dog hybrids arise: new insight into the eastern fringe of the Northern European wolf populationbioRxiv - Zoology 2023Quote: ... 5 μL Screen Mix (Evrogen), 1 μL of each primer (10 μM ...
-
bioRxiv - Cancer Biology 2023Quote: ... Primers CDKN1B-forv 5’-attagctagcATGTCAAACGTGCGAGTGTCTAA-3’ and CDKN1B-rev 5’-taatggatccTTACGTTTGACGTCTTCTGAGGC-3’ (Evrogen, Moscow, Russia) containing NheI and BamHI restriction sites were used for amplification ...
-
bioRxiv - Microbiology 2020Quote: ... The fixed cells were harvested (8000 g, 5 min, 4 °C) and resuspended in 1 mL of ExtractRNA Reagent (Evrogen, Russia) and the subsequent procedures were performed according to manufacturer’s instructions ...
-
bioRxiv - Immunology 2021Quote: Phagemid DNA was isolated from bacterial cells using the Plasmid miniprep kit (Evrogen, Russia). VHH-coding sequences were sequenced with Lac-prom (5’-CTTTATGCTTCCGGCTCGTATG-3’ ...
-
bioRxiv - Biochemistry 2020Quote: ... plasmid # 162785 Plasmids for cell transfections were purified by the Plasmid Midiprep kit (Evrogen, Moscow, Russia) and concentrated by ethanol precipitation in sterile conditions.
-
bioRxiv - Cell Biology 2019Quote: ... TagRFP fragment without start codon was obtained by PCR with TagRFP-woATG-F 5’-GT CGGTACCGTGTCTAAGGGCGAAGAGCTG-3’ n BFPX3-R 5’-GCGCTTAAGTTAATTAAGCTTGTGCCCCA-3’ primers and pTagRFP-N vector (Evrogen) as a DNA source ...
-
bioRxiv - Plant Biology 2020Quote: Amplification of TALE genes was performed via a two-step PCR process in conjunction with primers 5’-GATCCCATTCGTTCGCGCACACCAAGTC-3’ and 5’-CTCCATCAACCATGCGAGCTCCTCTTCG-3’ and Taq DNA polymerase (Evrogen, Russia) under the following conditions ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Molecular Biology 2023Quote: ... All cell lines were repeatedly tested for the presence of mycoplasma contamination with a MycoReport Mycoplasma Detection Kit (Evrogen, Russia).
-
bioRxiv - Immunology 2021Quote: ... ScreenMix Kit (Evrogen) was used according to the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Pathology 2020Quote: ... Quick-TA kit (Evrogen JSC) was used for cloning ...
-
bioRxiv - Immunology 2021Quote: Tersus Plus PCR Kit (Evrogen) was used for all amplification procedures ...
-
bioRxiv - Genomics 2020Quote: Encyclo PCR Kit (Evrogen, Russia) was used for the evaluation of the transposable element analysis ...
-
bioRxiv - Cancer Biology 2023Quote: ... OneTube RT-PCR SYBR kit (Evrogen) was used for cDNA production by reverse transcription followed by qPCR ...
-
bioRxiv - Cell Biology 2021Quote: ... for reverse transcription (MMLV RT kit) and for real time PCR (HS SYBR kit) were obtained from Evrogen, Russia ...
-
bioRxiv - Cell Biology 2020Quote: Cells were maintained in anti-bleaching live cell visualization medium (DMEMgfp; Evrogen), supplemented with 10% fetal bovine serum at 37°C in 5% CO2 ...
-
bioRxiv - Cell Biology 2020Quote: ... Cells were maintained in anti-bleaching live cell visualization medium (DMEMgfp; Evrogen), supplemented with 10% fetal bovine serum at 37°C in 5% CO2 and rutin at a final concentration of 20 mg/l.
-
bioRxiv - Molecular Biology 2021Quote: ... with a Screen Mix-HS polymerase kit (Evrogen). Amplifications were performed using a S1000™ thermal cycler (Bio-Rad ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: RNA was isolated using the ExtractRNA kit (Evrogen). RNA concentration was determined using a Nanodrop One C spectrophotometer (Thermo Fisher Scientific) ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Using the Tersus Plus PCR kit (Evrogen, PK221), blunting of the protruding ends in combination with A-tail treatment was performed ...
-
bioRxiv - Cell Biology 2019Quote: ... Cells were imaged in DMEM gfp-2 anti-bleaching live-cell imaging medium (Evrogen) supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Plant Biology 2020Quote: ... RNA was extracted using the ExtractRNA kit (Evrogen, Russia), the quality and quantity of preparations of total RNA and RNA from polysomal and monosomal fractions of plants was evaluated on an Agilent Bioanalyzer 2100 ...
-
bioRxiv - Plant Biology 2020Quote: ... thermocycler using the ScreenMix-HS kit (Evrogen, Moscow, Russia). The PCR cycling conditions were as follows ...
-
bioRxiv - Zoology 2019Quote: RNA extraction was performed using a ExtractRNA kit (Evrogen). An Agilent Technologies 2100 Bioanalyzer or 2200 TapeStation were used to establish that the RNA Integrity Number (RIN ...
-
bioRxiv - Neuroscience 2020Quote: ... Libraries were normalized using the Evrogen Trimmer kit (Evrogen). Libraries were sequenced as 50 bp single-end reads at the Emory University genomics core facility using Illumina GAIIX ...
-
bioRxiv - Genomics 2020Quote: Normalization was done using Trimmer Kit (Evrogen, Moscow, Russia). One μg pooled GBS library in 12 μl was mixed with a 4 μl 4x hybridization buffer ...
-
bioRxiv - Biochemistry 2024Quote: ... cDNA was synthesized using the MMLV RT kit (Evrogen) with random decanucleotide primers ...
-
bioRxiv - Genomics 2022Quote: Reverse transcription was performed using MMLV RT kit (Evrogen SK021). The synthesis was primed with oligo(dT) ...
-
bioRxiv - Molecular Biology 2021Quote: ... smegmatis genomic DNA by using Tersus Plus PCR kit (Evrogen) with primers (−47 ...
-
bioRxiv - Biochemistry 2020Quote: ... First strand of cDNA was synthesized using Mint kit (Evrogen) with primers for k-chain (TTG TCG TTC ACT GCC ATC AAT C) ...
-
bioRxiv - Immunology 2021Quote: ... The restricted polynucleotides were purified with Cleanup Standard Kit (Evrogen) and ligated with T4 DNA ligase in the corresponding buffer (Evrogen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... A custom normalization step (based on the EVROGEN Trimmer kit) was optimized in collaboration with the Roche R&D department and applied to the cDNA libraries ...
-
bioRxiv - Genomics 2020Quote: ... was performed using the Trimmer-2 cDNA normalisation kit (Evrogen) following the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2019Quote: DNA amplification was performed using the Encyclo PCR Kit (Evrogen) on a PTC-200 Thermal Cycler (MJ Research) ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplification was performed using EncycloPlus PCR kit (Evrogen, Moscow, Russia) using the following program ...