Labshake search
Citations for Evrogen :
1 - 50 of 100 citations for Human Lysine K Specific Demethylase 1A KDM1A ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Systems Biology 2019Quote: ... Tissue-specific cDNA libraries were created using the Mint-2 cDNA Synthesis Kit (Evrogen, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2022Quote: ... following a duplex-specific nuclease (DSN, Evrogen) digestion ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... This suspension was subjected to the DNA isolation by ExtractDNA Blood kit (Proteinase K plus SDS based lysis and silica-membrane purification; Evrogen, Russia), according to the manufacturer protocol.
-
bioRxiv - Genomics 2023Quote: ... 1 μL of preheated duplex-specific nuclease (Evrogen) was added to the reaction and incubated at 80 °C for 15 min ...
-
bioRxiv - Molecular Biology 2022Quote: ... supplemented with 1× Duplex-Specific Nuclease (DSN) buffer (Evrogen), slow-ramped (3°C/min ...
-
bioRxiv - Plant Biology 2023Quote: ... a Duplex-specific nuclease (DSN) treatment was done using the commercial enzyme from EVROGEN following manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2020Quote: ... DNA molecules corresponding to the rRNA transcripts were depleted using the duplex-specific nuclease (Evrogen), as described elsewhere (42) ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... with the addition of an enzymatic repeats depletion step using a Duplex-Specific Nuclease (DSN; Evrogen, Moscow, Russia) (Matvienko et al. ...
-
bioRxiv - Physiology 2023Quote: ... with 1% beta-mercaptoethanol in a 1.5-ml tube using a polypropylene pestle and a drill and then incubated (55 °C, 10 min) with protein kinase K (Evrogen, Russia). Total RNA was extracted by a silica spin column (CleanRNA Standard ...
-
bioRxiv - Systems Biology 2019Quote: ... The normalization of cDNA was performed using the DNS (duplex-specific nuclease) in accordance with the manufacturer’s protocol (Evrogen, Russia). Normalized and non-normalized cDNA libraries (100 ng of each sample ...
-
bioRxiv - Genetics 2019Quote: ... Fragments ranging from 100 to 150 bp and from 450 to 550 bp were isolated and normalized to reduce the relative number of highly expressed genes (Zhulidov et al. 2004) using double strand specific nuclease (Evrogen, Moscow, Russia). The normalized cDNA was PCR amplified for 17 or 18 cycles ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Immunology 2021Quote: ... ScreenMix Kit (Evrogen) was used according to the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Pathology 2020Quote: ... Quick-TA kit (Evrogen JSC) was used for cloning ...
-
bioRxiv - Immunology 2021Quote: Tersus Plus PCR Kit (Evrogen) was used for all amplification procedures ...
-
bioRxiv - Genomics 2020Quote: Encyclo PCR Kit (Evrogen, Russia) was used for the evaluation of the transposable element analysis ...
-
bioRxiv - Cancer Biology 2023Quote: ... OneTube RT-PCR SYBR kit (Evrogen) was used for cDNA production by reverse transcription followed by qPCR ...
-
bioRxiv - Cell Biology 2021Quote: ... for reverse transcription (MMLV RT kit) and for real time PCR (HS SYBR kit) were obtained from Evrogen, Russia ...
-
bioRxiv - Molecular Biology 2021Quote: ... with a Screen Mix-HS polymerase kit (Evrogen). Amplifications were performed using a S1000™ thermal cycler (Bio-Rad ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: RNA was isolated using the ExtractRNA kit (Evrogen). RNA concentration was determined using a Nanodrop One C spectrophotometer (Thermo Fisher Scientific) ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Using the Tersus Plus PCR kit (Evrogen, PK221), blunting of the protruding ends in combination with A-tail treatment was performed ...
-
bioRxiv - Biochemistry 2024Quote: ... woodyi cells using an RNA Solo kit (Evrogen) and additionally digested with RNase-free DNase I (Thermo Scientific ...
-
bioRxiv - Plant Biology 2020Quote: ... RNA was extracted using the ExtractRNA kit (Evrogen, Russia), the quality and quantity of preparations of total RNA and RNA from polysomal and monosomal fractions of plants was evaluated on an Agilent Bioanalyzer 2100 ...
-
bioRxiv - Plant Biology 2020Quote: ... thermocycler using the ScreenMix-HS kit (Evrogen, Moscow, Russia). The PCR cycling conditions were as follows ...
-
bioRxiv - Zoology 2019Quote: RNA extraction was performed using a ExtractRNA kit (Evrogen). An Agilent Technologies 2100 Bioanalyzer or 2200 TapeStation were used to establish that the RNA Integrity Number (RIN ...
-
bioRxiv - Neuroscience 2020Quote: ... Libraries were normalized using the Evrogen Trimmer kit (Evrogen). Libraries were sequenced as 50 bp single-end reads at the Emory University genomics core facility using Illumina GAIIX ...
-
bioRxiv - Genomics 2020Quote: Normalization was done using Trimmer Kit (Evrogen, Moscow, Russia). One μg pooled GBS library in 12 μl was mixed with a 4 μl 4x hybridization buffer ...
-
bioRxiv - Biochemistry 2024Quote: ... cDNA was synthesized using the MMLV RT kit (Evrogen) with random decanucleotide primers ...
-
bioRxiv - Genomics 2022Quote: Reverse transcription was performed using MMLV RT kit (Evrogen SK021). The synthesis was primed with oligo(dT) ...
-
bioRxiv - Molecular Biology 2021Quote: ... smegmatis genomic DNA by using Tersus Plus PCR kit (Evrogen) with primers (−47 ...
-
bioRxiv - Biochemistry 2020Quote: ... First strand of cDNA was synthesized using Mint kit (Evrogen) with primers for k-chain (TTG TCG TTC ACT GCC ATC AAT C) ...
-
bioRxiv - Immunology 2021Quote: ... The restricted polynucleotides were purified with Cleanup Standard Kit (Evrogen) and ligated with T4 DNA ligase in the corresponding buffer (Evrogen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... A custom normalization step (based on the EVROGEN Trimmer kit) was optimized in collaboration with the Roche R&D department and applied to the cDNA libraries ...
-
bioRxiv - Genomics 2020Quote: ... was performed using the Trimmer-2 cDNA normalisation kit (Evrogen) following the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2019Quote: DNA amplification was performed using the Encyclo PCR Kit (Evrogen) on a PTC-200 Thermal Cycler (MJ Research) ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplification was performed using EncycloPlus PCR kit (Evrogen, Moscow, Russia) using the following program ...
-
bioRxiv - Plant Biology 2022Quote: cDNA was synthesized using the MMLV RT kit (Evrogen, Russian) according to the manufacturer’s recommendations ...
-
bioRxiv - Molecular Biology 2023Quote: ... cDNA was synthesized using the MMLV reverse transcription kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Plant Biology 2023Quote: ... After purification using the Cleanup Standard kit (Evrogen, Moscow, Russia), the restriction products were ligated using T4 ligase (Evrogen ...
-
bioRxiv - Molecular Biology 2020Quote: ... pET-NS1 was purified using a Plasmid Miniprep Kit (Evrogen, BC021). Commercial plasmid sequencing was performed using T7 primers at Evrogen (Moscow ...
-
bioRxiv - Cell Biology 2021Quote: ... The fragment was purified using a Cleanup Standard kit (Evrogen, Russia), digested with EcoRI and KpnI enzymes (SibEnzyme ...
-
bioRxiv - Biochemistry 2023Quote: ... RT-qPCR assays were performed with qPCRmix-HS SYBR kit (Evrogen), using the cDNA preparations as templates and 5’-GCAAGCGCATTTCAAGGAC / 5’-CCAGCGGGTGAAGTTCGTAG as primer pair for crdB ...
-
bioRxiv - Cancer Biology 2023Quote: RNA was extracted from cultured cells using the ExtractRNA kit (Evrogen) according to the manufacturer’s protocol ...