Labshake search
Citations for Evrogen :
1 - 50 of 64 citations for Human IgM Anti Zika Virus NS1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2020Quote: ... pET-NS1 was purified using a Plasmid Miniprep Kit (Evrogen, BC021). Commercial plasmid sequencing was performed using T7 primers at Evrogen (Moscow ...
-
bioRxiv - Microbiology 2020Quote: ... This was incubated with the appropriate antibodies (anti-GFP polyclonal antibody and anti-tRFP antibody, Evrogen, reference # AB233) and revealed with Roche LumiLight ECL kit after incubation with secondary antibody.
-
bioRxiv - Plant Biology 2020Quote: ... an anti-TagRFP antibody (Evrogen) was added to the beads ...
-
bioRxiv - Molecular Biology 2023Quote: ... Anti-tRFP primary antibodies (Evrogen, Russia) were used with Goat anti-rabbit IgG-peroxidase conjugate (Sigma Aldrich ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-TagGFP2 antibody (Evrogen #AB121; 1:3000). HRP-conjugated secondary antibodies were purchased from The Jackson Laboratory.
-
bioRxiv - Molecular Biology 2020Quote: ... we used rabbit polyclonal Anti-tRFP and Anti-TurboGFP(d) antibodies (Evrogen, Russia) diluted at 1:7000 ...
-
bioRxiv - Biophysics 2024Quote: ... or an anti-KillerRed antibody (#AB961, Evrogen, Moscow, Russia) in CanGet signal immunoreaction enhancer solution 1 (TOYOBO ...
-
bioRxiv - Cell Biology 2022Quote: ... Mouse anti-Aub antibody (1:20) (Patil and Kai 2010) or mouse anti-mKate2 (Evrogen, 1:200) was added to the cleared lysate and incubated at 4°C for 2 h with rotation ...
-
bioRxiv - Pathology 2019Quote: ... The protein samples were detected with a polyclonal anti-tRFP antibody (Evrogen) for TagBFP ...
-
bioRxiv - Microbiology 2020Quote: ... Chlamydiae were stained with polyclonal a rabbit anti-tRFP antibody (Evrogen, Cat. # 233), which recognized the RFP mKate protein ...
-
bioRxiv - Neuroscience 2019Quote: ... They were then incubated with primary antibodies, rat monoclonal anti-GFP (Nacalai Tesque, GF090R) at 1:2000 and rabbit polyclonal anti-tRFP (Evrogen, AB233) at 1:2000 ...
-
bioRxiv - Cell Biology 2019Quote: ... Membranes were incubated overnight with rabbit anti-tagRFP (which recognise also tagBFP) or rabbit anti-tag(CGY)FP primary antibodies (both from Evrogen, Milan, Italy) at 1:5000 in PBST with 0.5% non-fat dry milk ...
-
bioRxiv - Cell Biology 2022Quote: ... and incubated with the antibody (mouse anti-GFP [Thermos Fisher Scientific, 3E6, 1:500] or mouse anti-mKate2 [Evrogen, AB233, 1:500]) overnight at 4°C ...
-
bioRxiv - Cancer Biology 2019Quote: ... Primary antibodies were used: anti-GFP in a titer of 1:8000 (AB011, Evrogen, Russia), anti-NCL in a titer of 1:7000 (#a300-711A ...
-
bioRxiv - Neuroscience 2020Quote: ... (ii) the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA ...
-
bioRxiv - Cell Biology 2022Quote: ... and in primary antibody (α-tRFP, [mKate antibody, Evrogen, AB233] ...
-
bioRxiv - Cell Biology 2020Quote: ... Input and bound fractions were subjected to SDS-PAGE followed by immunoblotting analysis with anti-TagRFP antibody (Evrogen, Moskau, Russia) and anti-GFP antibody (3H9 ...
-
bioRxiv - Molecular Biology 2020Quote: ... pre-washed cells were lysed in x1 Laemmli buffer and analyzed with one-dimensional PAGE followed by western blotting using Anti-TurboGFP(d) antibodies (Evrogen, Russia).
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Plant Biology 2020Quote: ... or anti-tRFP (Evrogen)) ...
-
bioRxiv - Cancer Biology 2020Quote: ... anti-KillerRed (Evrogen AB961). All ChIP was performed using the SimpleChIP Enzymatic Chromatin IP kit with magnetic beads according to the manufacturer’s instructions (Cell Signaling Technologies) ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2020Quote: ... Rabbit anti-Tag(CGY)FP (Evrogen) was used at 1:1000 to detect mTagGFP2 ...
-
bioRxiv - Cancer Biology 2020Quote: ... anti-mKate (1:2500, Evrogen #AB233), anti-Cas9 (1:500 ...
-
bioRxiv - Cancer Biology 2020Quote: ... anti-KillerRed (Evrogen AB961; 1:5000), and anti-β-actin (Cell Signaling Technologies 4967 ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-tagRFP (1:1000; AB233, Evrogen), anti-Por1 serum (1:2000 ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-TagGFP2 (Evrogen #AB121; 1:3000), anti-N1 ((Postigo & Way 2012) ...
-
bioRxiv - Microbiology 2024Quote: ... anti-RFP (1:2,000, AB233, Evrogen), rabbit anti-Src antibody (1:1000 ...
-
bioRxiv - Developmental Biology 2020Quote: ... and anti-tRFP Rabbit (Evrogen, 1:250). Secondary antibodies used were goat anti-Rabbit Alexa Fluor 488 (Invitrogen ...
-
bioRxiv - Genetics 2019Quote: ... rabbit anti-tRFP was from Evrogen (#AB233) and used against mKate2 to stain cystinosin-mKate2 ...
-
bioRxiv - Immunology 2022Quote: ... rabbit polyclonal anti-tagRFP (Evrogen, 1:1000). HRP-conjugated goat anti-mouse and goat anti-rabbit IgG (H+L ...
-
bioRxiv - Neuroscience 2021Quote: ... Rabbit anti-tRFP 1:500 (Evrogen AB233), Rabbit anti-S100 1:300 (VWR/ProteinTech 15146-1-AP) ...
-
bioRxiv - Cancer Biology 2023Quote: ... rabbit anti-RFP (Evrogen, AB234, 1:1000), chicken anti-GFP (Novus ...
-
bioRxiv - Neuroscience 2023Quote: ... and Anti-tRFP (rabbit polyclonal, AB233, Evrogen), both at 1:500 dilution ...
-
bioRxiv - Plant Biology 2023Quote: ... polyclonal anti-tBFP produced in rabbit (Evrogen) were used as primary antibodies ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-tagRFP (1:250, Evrogen AB233), chicken anti-PV (1:250 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-tagRFP (1:100, Evrogen AB233), goat anti-chicken biotin (1:200 ...
-
bioRxiv - Cancer Biology 2024Quote: ... The following primary antibodies were used: mKate2 (Evrogen #AB233, 1:1,000, IF), SMAD4 (Millipore #04-1033 ...
-
bioRxiv - Microbiology 2024Quote: ... and rabbit monoclonal antibodies to GFP (598; MBL) and TagRFP (AB233; Evrogen). Rabbit polyclonal antibodies to US11 were described previously 41 ...
-
bioRxiv - Biophysics 2019Quote: ... rabbit anti-tagRFP pAb (1:1000; ab233, Evrogen), mouse anti-PLB mAb (1:1000 ...
-
bioRxiv - Neuroscience 2020Quote: ... rabbit anti-tRFP (tagBFP, AB233, Evrogen, Moscow, Russia) and mouse anti-GAPDH (MAB374 ...
-
bioRxiv - Neuroscience 2022Quote: ... fRed (rabbit anti-tRFP, 1:500; AB233, Evrogen), or eGFP (chicken ...
-
bioRxiv - Cell Biology 2022Quote: ... Rabbit anti-turboGFP (AB513) was purchased from Evrogen. Goat anti-GFP (GTX26673 ...
-
bioRxiv - Cell Biology 2020Quote: ... and anti-tRFP (1:1000 Evrogen EVN-AB233-C100).
-
bioRxiv - Molecular Biology 2020Quote: ... rabbit anti-TagRFP (Evrogen: AB233; RRID: AB_2571743; 1:1,000) and mouse anti-β-actin conjugated to HRP (Sigma-Aldrich ...
-
bioRxiv - Genomics 2023Quote: ... 2: rabbit anti-tRFP (1:1,000 dilution, polyclonal, Evrogen, AB233). The following secondary antibodies were used ...