Labshake search
Citations for Evrogen :
1 - 50 of 52 citations for B7 1 CD80 Human HEK293 His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies (goat a-ChAT Millipore AB144P 1:200 and chicken a-RFP Rockland 600-901-379 1:1000 or rabbit a-tRFP Evrogen AB233 1:1000) were prepared in light blocking solution (3% NDS ...
-
bioRxiv - Developmental Biology 2021Quote: ... TagRFP (1: 1000, Evrogen, AB233), GFP (1 ...
-
bioRxiv - Neuroscience 2022Quote: ... TurboRFP (1:1000, Evrogen AB233), GFP (1:1000 ...
-
bioRxiv - Cancer Biology 2020Quote: ... anti-mKate (1:2500, Evrogen #AB233), anti-Cas9 (1:500 ...
-
bioRxiv - Cancer Biology 2020Quote: ... anti-KillerRed (Evrogen AB961; 1:5000), and anti-β-actin (Cell Signaling Technologies 4967 ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-tagRFP (1:1000; AB233, Evrogen), anti-Por1 serum (1:2000 ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-TagGFP2 (Evrogen #AB121; 1:3000), anti-N1 ((Postigo & Way 2012) ...
-
bioRxiv - Microbiology 2024Quote: ... anti-RFP (1:2,000, AB233, Evrogen), rabbit anti-Src antibody (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... Mouse anti-Aub antibody (1:20) (Patil and Kai 2010) or mouse anti-mKate2 (Evrogen, 1:200) was added to the cleared lysate and incubated at 4°C for 2 h with rotation ...
-
bioRxiv - Developmental Biology 2020Quote: ... and anti-tRFP Rabbit (Evrogen, 1:250). Secondary antibodies used were goat anti-Rabbit Alexa Fluor 488 (Invitrogen ...
-
bioRxiv - Immunology 2022Quote: ... rabbit polyclonal anti-tagRFP (Evrogen, 1:1000). HRP-conjugated goat anti-mouse and goat anti-rabbit IgG (H+L ...
-
bioRxiv - Neuroscience 2021Quote: ... Rabbit anti-tRFP 1:500 (Evrogen AB233), Rabbit anti-S100 1:300 (VWR/ProteinTech 15146-1-AP) ...
-
bioRxiv - Cancer Biology 2023Quote: ... rabbit anti-RFP (Evrogen, AB234, 1:1000), chicken anti-GFP (Novus ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-TagGFP2 antibody (Evrogen #AB121; 1:3000). HRP-conjugated secondary antibodies were purchased from The Jackson Laboratory.
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-tagRFP (1:250, Evrogen AB233), chicken anti-PV (1:250 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-tagRFP (1:100, Evrogen AB233), goat anti-chicken biotin (1:200 ...
-
bioRxiv - Biophysics 2019Quote: ... rabbit anti-tagRFP pAb (1:1000; ab233, Evrogen), mouse anti-PLB mAb (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... fRed (rabbit anti-tRFP, 1:500; AB233, Evrogen), or eGFP (chicken ...
-
bioRxiv - Genomics 2023Quote: ... 1 μL of preheated duplex-specific nuclease (Evrogen) was added to the reaction and incubated at 80 °C for 15 min ...
-
Molecular coevolution of nuclear and nucleolar localization signals inside basic domain of HIV-1 TatbioRxiv - Evolutionary Biology 2021Quote: ... The membranes were blocked in 1% bovine serum albumin and incubated with either a monoclonal antibody against GFP (1:3000; Evrogen, Moscow, Russia) or a monoclonal antibody against B23 (1:10,000 ...
-
bioRxiv - Cell Biology 2021Quote: ... Blots were incubated overnight at 4°C with primary antibodies targeting Tag(CGY)FP (1:2000 dilution in 1% milk, Evrogen, Cat#: AB121), HaloTag (1:1000 dilution in 0.5% milk ...
-
bioRxiv - Cell Biology 2022Quote: ... and incubated with the antibody (mouse anti-GFP [Thermos Fisher Scientific, 3E6, 1:500] or mouse anti-mKate2 [Evrogen, AB233, 1:500]) overnight at 4°C ...
-
bioRxiv - Cell Biology 2020Quote: ... and anti-tRFP (1:1000 Evrogen EVN-AB233-C100).
-
bioRxiv - Molecular Biology 2020Quote: ... rabbit anti-TagRFP (Evrogen: AB233; RRID: AB_2571743; 1:1,000) and mouse anti-β-actin conjugated to HRP (Sigma-Aldrich ...
-
bioRxiv - Molecular Biology 2022Quote: ... supplemented with 1× Duplex-Specific Nuclease (DSN) buffer (Evrogen), slow-ramped (3°C/min ...
-
bioRxiv - Cell Biology 2019Quote: ... or 1:1000 rabbit α-RFP (AB233, Evrogen, Moscow, Russia). The following secondary antibodies were then used at 1:5000 dilution ...
-
bioRxiv - Genomics 2023Quote: ... 2: rabbit anti-tRFP (1:1,000 dilution, polyclonal, Evrogen, AB233). The following secondary antibodies were used ...
-
bioRxiv - Cell Biology 2024Quote: ... Anti-tRFP (Cat#AB233, 1:1000) was purchased from Evrogen. Anti-CDK11A (Cat#ARP61814_P050 ...
-
bioRxiv - Neuroscience 2022Quote: ... 500-1000 μl of rabbit anti fRed (1:500; AB233, Evrogen) primary antibody was used per slice in a 2 ml Eppendorf tube ...
-
bioRxiv - Zoology 2019Quote: ... and rabbit polyclonal for turboRFP/mKate2 (diluted 1:500; Evrogen AB234). Secondary antibodies (all diluted 1:2000) ...
-
bioRxiv - Neuroscience 2021Quote: ... Cells were then incubated with anti-tagRFP (1:1,000, Evrogen, AB233), anti-SMI312 (1:1,000 ...
-
bioRxiv - Cell Biology 2022Quote: ... Protein samples were detected with 1:1000 diluted anti-RFP (AB233; Evrogen) for BORR:RFP detection and 1:2000 diluted anti-Histone H3 (ab1791 ...
-
bioRxiv - Cancer Biology 2024Quote: ... The following primary antibodies were used: mKate2 (Evrogen #AB233, 1:1,000, IF), SMAD4 (Millipore #04-1033 ...
-
bioRxiv - Genomics 2023Quote: ... 1.5 µl of dATP (10 mM) and 1 µl Encyclo polymerase (Evrogen, Moscow, Russia). The mixture was incubated at 37°C for 30 minutes followed by 5□min at 72□°C ...
-
bioRxiv - Molecular Biology 2021Quote: ... 1 mcg of total RNA was used for reverse transcription with MMLV-RT kit (Evrogen) according to the recommended protocol with oligo(dT)15 and random (dN)10 primers at a ratio of 1:3 ...
-
bioRxiv - Cancer Biology 2019Quote: ... Primary antibodies were used: anti-GFP in a titer of 1:8000 (AB011, Evrogen, Russia), anti-NCL in a titer of 1:7000 (#a300-711A ...
-
bioRxiv - Neuroscience 2020Quote: ... (ii) the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA ...
-
bioRxiv - Cell Biology 2023Quote: ... and anti-Tag(CGY)FP (1:2000 in 0.5% milk TBST, 4°C o/n, Evrogen AB121). Blots were then incubated with IRDye 800/680 conjugated antibodies (1:10000 in 5% milk TBST ...
-
bioRxiv - Genomics 2020Quote: ... with cDNAs were incubated at 68 °C for 2 minutes before adding pre-warmed DSN buffer mix with 1 Units of DSN enzyme (Evrogen). The reaction then performed at 68 °C for 20 minutes ...
-
bioRxiv - Neuroscience 2023Quote: ... was used to visualize LC neurons and rabbit anti-red fluorescent protein to visualise the fRed tag (tRFP, 1:1000, Evrogen). For visualisation of GRABNE2m expression in the hippocampus ...
-
bioRxiv - Cancer Biology 2023Quote: ... cDNA was synthesized by random priming from 1 μg of total RNA using the MMLV RT kit (Evrogen, Moscow, Russia). These samples were subjected to qPCR using CFX96 Real-Time PCR Detection System (Bio-Rad ...
-
bioRxiv - Neuroscience 2019Quote: ... They were then incubated with primary antibodies, rat monoclonal anti-GFP (Nacalai Tesque, GF090R) at 1:2000 and rabbit polyclonal anti-tRFP (Evrogen, AB233) at 1:2000 ...
-
bioRxiv - Microbiology 2020Quote: ... The fixed cells were harvested (8000 g, 5 min, 4 °C) and resuspended in 1 mL of ExtractRNA Reagent (Evrogen, Russia) and the subsequent procedures were performed according to manufacturer’s instructions ...