Labshake search
Citations for Biomatik Corporation :
1 - 50 of 55 citations for Mouse Anti Hepatitis C Virus Core Protein Antibody 1864 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Immunology 2022Quote: ... and Vaccinia virus B8R (TSYKFESV, Biomatik).
-
bioRxiv - Molecular Biology 2022Quote: ... Transfected C2C12 cells were fixed and stained following the same protocol and incubated overnight in 5% FBS and 0.1% triton-X 100 in PBS at 4°C with the following antibodies: anti-mLIMCH1 (1:200, Biomatik), anti-Myc (1:200 ...
-
bioRxiv - Physiology 2022Quote: Antibodies used were rabbit anti phosphatidylserine (Biomatik, CA30389), mouse anti KCNJ2 (Sigma ...
-
bioRxiv - Physiology 2019Quote: ... C-reactive protein (CRP) levels were measured using a human high-sensitivity CRP (hs-CRP) ELISA kit (Biomatik, Canada) as per the manufacturer’s instructions ...
-
bioRxiv - Developmental Biology 2020Quote: ... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... An HRP-conjugate and anti-testosterone antibody (Biomatik, #EKC40192) were added to each well ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A 27-amino acid B16-M30 peptide with N-terminal biotin and C-terminal polyhistidine (6xHis) motif for antibody-based detection was synthesized by Biomatik to ~85% purity ...
-
bioRxiv - Molecular Biology 2019Quote: ... and 2.5 μL of FITC-conjugated anti-dihydrotestosterone antibody (Biomatik, Wilmington, DE) were added to the cell solution ...
-
bioRxiv - Bioengineering 2023Quote: Fluorescein-tagged C-peptide (C-peptide*) was purchased from Biomatik (Ontario, Canada). Stocks of the C-peptide* in 2% DMSO were stored at -80 °C and diluted in BMHH imaging buffer (125 mM NaCl ...
-
bioRxiv - Immunology 2021Quote: ... mGPIc-c (10uM, Biomatik), galCOL2259–273 (10µgml−1 ...
-
bioRxiv - Bioengineering 2023Quote: ... C-peptide (Biomatik, Canada) was serially diluted in BMHH buffer with a fixed concentration of C-peptide* (100 nM ...
-
bioRxiv - Molecular Biology 2024Quote: ... C-terminal peptides (Biomatik) were dissolved in 200 mM ammonium acetate (pH 6.9) ...
-
bioRxiv - Molecular Biology 2021Quote: ... rabbit polyclonal affinity-purified anti-eIF4E-3 antibodies #967 and #968 1:300 (Biomatik, Ontario, Canada, (40)) anti-GW182 and anti-TIA-1 (AbCam ...
-
bioRxiv - Immunology 2021Quote: ... Following stimuli were used: hGPIc-c (10µM; Biomatik), mGPIc-c (10uM ...
-
bioRxiv - Physiology 2020Quote: ... and Substance P ELISA (mouse, Biomatik #EKC37868) kit ...
-
bioRxiv - Microbiology 2021Quote: ... a C-terminal amidated cheopin was chemically synthesized (Biomatik, Wilmington, DE). The purity (>92% ...
-
bioRxiv - Immunology 2021Quote: Arthritis was induced by the hGPIc-c peptide (NH2-IWYINCFGCETHAML-OH; Biomatik) emulsified with an equal volume of complete Freund’s adjuvant ...
-
bioRxiv - Biochemistry 2020Quote: ... and the TNF-α mouse ELISA kit (Biomatik, EKA51917), respectively ...
-
bioRxiv - Cell Biology 2024Quote: ... at 50°C for 1 hour and 0.125 mg/mL Proteinase K (Biomatik) for an additional hour at 50°C ...
-
bioRxiv - Developmental Biology 2019Quote: ... The dilutions of the primary antibodies were as follows: a-RpS5b (peptide antibody generated by Biomatik) 1:1000 ...
-
bioRxiv - Neuroscience 2021Quote: Peptides P1 and P2 from mouse NMDAR1 were synthesized by Biomatik. The P1 (KLVQVGIYNGTHVIPNDRKI ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting antibody was validated by Biomatik with ELISA (>1:32,000 ...
-
bioRxiv - Neuroscience 2024Quote: ... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
bioRxiv - Systems Biology 2021Quote: ... genes encoding for these proteins were synthesised by commercial gene synthesis services (Biomatik). Target genes were sub-cloned into the cell-free expression vector pEUE01-His-N2 (CellFree Sciences ...
-
bioRxiv - Developmental Biology 2019Quote: ... a-RpS5a (peptide antibody was generated by Biomatik) 1 ...
-
bioRxiv - Neuroscience 2024Quote: ... The Serpina3n concentration was determined using the mouse Serpina3n ELISA kit (BIOMATIK, EKF58884). ELISA was performed according to the manufacturer’s instruction.
-
bioRxiv - Developmental Biology 2019Quote: ... pUASt-Pits was generated by synthesis of pits transcript variant C (NM_132581.3) flanked by BglII and XhoI sites (Biomatik) and subcloning into pUASt.
-
bioRxiv - Molecular Biology 2021Quote: Plasmids bearing CLEC16A C-terminal IDPR mutation for mammalian overexpression studies were generated by gene synthesis into pBSK(+) (Biomatik) that were subsequently subcloned into pFLAG-CMV-5a ...
-
bioRxiv - Molecular Biology 2020Quote: ... RVPQQDWL and KMSPRVPQQDWLSQ peptides were synthesized with the TAT sequence (GRKKRRQRRRG) at N- and C-terms (HCl salts; Biomatik). Peptides (final 400 μM in PBS ...
-
bioRxiv - Cell Biology 2020Quote: ... anti-Cit150 (Biomatik, 1:4000), anti-β-actin (Abcam ab8224 ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-mLIMCH1 (1:200, Biomatik), anti-RYR1 (1:200 ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Molecular Biology 2022Quote: ... peptide corresponding to CaMKIIα positions 294-315 (sequence NARRKLKGAILTTMLATRNFSG, acetylated at N-terminus, amidated at C-terminus) was synthesised by Biomatik at > 95 % purity ...
-
bioRxiv - Molecular Biology 2022Quote: ... and anti-mLIMCH1 (1:400, Biomatik). Membranes were washed three times with PBS-T and incubated for one hour at room temperature in HRP-conjugated goat anti–rabbit or goat anti-mouse secondary antibody (1:10,000 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-GABRB3 (Biomatik, 1:500),22 rabbit anti-MeCP2 (Michael Greenberg ...
-
bioRxiv - Immunology 2023Quote: Detection of NRG1 levels was performed using mouse NRG1 ELISA kit (cat# EKN47308, Biomatik, Delaware USA) following manufacturer’s instructions ...
-
bioRxiv - Immunology 2023Quote: ... the SC and V2 domains were cloned into the pET15b expression vector as dual His (N-terminal) and Myc (C-terminal) tagged recombinant constructs (Biomatik, USA). A duplicate set of expression constructs were also cloned into the pGEX-4T-1 expression vector as single-tagged GST (N-terminal ...
-
bioRxiv - Cell Biology 2022Quote: ... The rabbit anti-BUBR1-pS676 antibody was raised against phospho-S676 of human BUBR1 using the following peptide C-PIIED[pS]REATH (custom made by Biomatik, 1:200). The rabbit anti-BUBR1-pS670 antibody was raised against phosphor-Ser 670 of human BUBR1 (Nijenhuis et al. ...
-
bioRxiv - Cell Biology 2019Quote: ... The rabbit anti-BUB1-p609 antibody was raised against phospho-Thr 609 of human BUB1 using the following peptide C-AQLAS[pT]PFHKLPVES (custom raised by Biomatik, 1:1000). The rabbit anti-BUBR1-p620 antibody was raised against phospho-Thr 620 of human BUBR1 using the following peptide C-AARFVS[pT]PFHE (custom raised by Moravian ...
-
bioRxiv - Cell Biology 2022Quote: ... The Miro1 protein level in each sample collected was determined using the RHOT1 ELISA Kit 96T (EKL54911, Biomatik) according to the manufacturer’s manual ...
-
bioRxiv - Cell Biology 2023Quote: ... Urinary levels of low-molecular weight Clara cell protein (CC16) were measured by using an enzyme-linked immunosorbent assay in according to the manufacturer’s instructions (BIOMATIK EKU03200 ...
-
bioRxiv - Microbiology 2021Quote: ... or anti-GFP (#CAU20008, Biomatik Corporation, Cambridge, Canada) diluted 1:2000 and 1:3000 in PBST ...
-
bioRxiv - Biochemistry 2020Quote: ... Levels of leptin and TNF-α were determined in undiluted samples using the Leptin mouse ELISA kit (Biomatik, EKB01861) and the TNF-α mouse ELISA kit (Biomatik ...
-
bioRxiv - Cell Biology 2022Quote: ... and rabbit anti-BUBR1-pS676 (custom raised by Biomatik, and used at 1:750 in ReliaBLOT® Block – Bethyl labs - after blocking in ReliaBLOT® Block ...
-
bioRxiv - Biochemistry 2023Quote: ... Beads were washed four times with ice-cold lysis buffer and proteins were eluted by adding 150 µg of 3xFlag peptide (Biomatik, 56305) competitor and gently rocking for 30 minutes at room temperature ...
-
bioRxiv - Biochemistry 2020Quote: ... Levels of adiponectin in the CM were determined after a 1:1000 dilution using the adiponectin mouse ELISA kit (Biomatik, EKL54022). Levels of IL-6 were measured after a 1:2 CM dilution using the IL-6 mouse ELISA kit (Thermo-Fisher ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A comprehensive library of human protein domains that potentially read methyllysine marks was cloned into a pGEX vector by Biomatik (Cambridge, Canada) using gene synthesis to best optimize the open reading frames for bacterial expression ...
-
bioRxiv - Neuroscience 2023Quote: ... Depletion of p11 from the media was confirmed using Rat S100 Calcium Binding Protein A10 (S100A10) ELISA Kit (Biomatik, Cat# EKN48271-96T) as per the attached instructions.
-
bioRxiv - Cell Biology 2019Quote: ... rabbit anti-BUB1-p609 (custom raised by Biomatik, 1:1000), rabbit anti-BUBR1-p620 (custom raised by Moravian ...