Labshake search

Citations for Eurogentec :

101 - 101 of 101 citations for Recombinant Rabbit CCL19 Protein since 2019

Citations are collected from bioRxiv only, the total number of publications could be much larger.

  • Vanessa Dimchev, et al., bioRxiv - Cell Biology 2020
    Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
Feedback