Labshake search
Citations for Eurogentec :
101 - 150 of 165 citations for Rabbit Anti SARS Coronavirus Nucleocapsid Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Zoology 2020Quote: ... They were raised in rabbits using the speedy protocol from Eurogentec (Seraing, Belgium) and purified against the same peptide before using for immunofluorescence at 1:200.
-
bioRxiv - Plant Biology 2019Quote: ... The purified recombinant protein was used to immunize rabbits by a company (Eurogentec). From the immunserum a crude IgG fraction was isolated by ammonium sulfate precipitation then IgG was further purified on protein gel blots of the antigen ...
-
bioRxiv - Plant Biology 2020Quote: ... synthetic peptides (Fig. S9) were used for rabbit immunization and affinity chromatography (Eurogentec). For assessing the specificity and cross-reaction of the antibodies ...
-
bioRxiv - Biochemistry 2021Quote: ... The polyclonal TbUbL1 rabbit antisera used for immunoblots was produced commercially by Eurogentec using peptide sequence CSEISGNHRSSEHNAG ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody was produced by Eurogentec (Seraing, Belgium).
-
bioRxiv - Evolutionary Biology 2021Quote: ... lobularis were obtained by immunizing rabbits using the speedy protocol from Eurogentec (Seraing, Belgium) with a synthetic peptide (QTISDPGEEDPPVSKC ...
-
bioRxiv - Microbiology 2020Quote: ... Primary antibodies against Hcp (Eurogentec; Metzger et al., 2016) were used at 1:5,000 dilution while anti-Sigma70-HRP antibodies (BioLegend ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...
-
bioRxiv - Genomics 2020Quote: ... A commercial monoclonal antibody against 5-methylcytidine from Eurogentec was used for immunoprecipitation ...
-
bioRxiv - Cell Biology 2021Quote: ... Polyclonal antibodies were raised against the fusion protein (Eurogentec). Immuno-reactive complexes were detected using horseradish-peroxidase coupled anti-rabbit or anti-mouse antibodies (Sigma-Aldrich/Merck ...
-
bioRxiv - Molecular Biology 2019Quote: ... Pab-DnaG or Pab-aCPSF1 (custom polyclonal antibodies, Eurogentec) diluted 10,000-fold and an anti-rabbit IgG HRP conjugate (Promega ...
-
bioRxiv - Developmental Biology 2022Quote: ... Antibodies were raised in two guinea pigs by Eurogentec.
-
bioRxiv - Microbiology 2021Quote: Rabbits were immunized with recombinant ACS according to the manufacturer’s standard procedures (Eurogentec, Seraing, Belgium). Reactivity of serum was compared to pre-immune serum using an enzyme-linked immunosorbent assay ...
-
bioRxiv - Plant Biology 2020Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Plant Biology 2022Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-BBX22(199–213) (Eurogentec, raised in rabbits against the peptide C+DQSYEYMENNGSSKT and affinity purified) ...
-
bioRxiv - Cell Biology 2023Quote: Purified recombinant TbSmee1(1-400) was used for the generation of two polyclonal rabbit antisera (Eurogentec). Antisera (303 ...
-
bioRxiv - Cell Biology 2020Quote: ... or pHH3 ser10 (custom antibody to peptide ARTKQTARKS*TGGKAPRKQLASK: Eurogentec) overnight at 4°C ...
-
bioRxiv - Microbiology 2021Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody using an ImageQuant LAS 4000 mini digital imaging system (GE Healthcare) ...
-
bioRxiv - Cancer Biology 2022Quote: ... HPV-16 E7 pS31/S32 peptide antibody generated by Eurogentec has been described previously [12] ...
-
bioRxiv - Biochemistry 2021Quote: ... The antibody was affinity purified against the antigen by Eurogentec, and used at a 1:50 dilution ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti- rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Proteins were probed via α-DnaD polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Developmental Biology 2019Quote: ... The antibody was produced in guinea pigs by Eurogentec (Liège, Belgium).
-
bioRxiv - Microbiology 2021Quote: ... Gel portions containing CcrZ was sent for antibody production by Eurogentec.
-
bioRxiv - Microbiology 2020Quote: ... Purified CexE protein was used to produce primary antibodies by Eurogentec using the 28-day speedy protocol ...
-
bioRxiv - Cell Biology 2023Quote: A custom polyclonal antibody to RAB18 generated by Eurogentec (Southampton, UK) has been described previously (10) ...
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Neuroscience 2023Quote: ... The synthetic peptide was conjugated to keyhole limpet hemocyanin for immunization of rabbits and guinea pigs (Eurogentec, Belgium). Resulting sera were affinity-purified on the peptide antigen and the specificity of the resulting antibodies was confirmed using lysates and tissue sections from Rbm20 knock-out mice.
-
bioRxiv - Microbiology 2020Quote: ... and those with Hcp pooled and used to generate polyclonal antibodies (EuroGentec).
-
bioRxiv - Cell Biology 2023Quote: ... A third polyclonal antibody (508) was generated against two TbSmee1 peptides (Eurogentec) and affinity purified using the peptide antigens immobilised on a Sulfolink affinity column (ThermoFisher) ...
-
bioRxiv - Developmental Biology 2019Quote: ... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Neuroscience 2019Quote: The custom-made CNK2 antibody used in this study was produced by Eurogentec. It was raised in guinea pig against a KHL-conjugated peptide representing CNK2 amino-acids 727-741 and affinity matrix purified ...
-
bioRxiv - Molecular Biology 2019Quote: ... a polyclonal exWAGO antibody was used (generated and purified against peptides TKQTKDDFPEQERK, Eurogentec) overnight at 4°C ...
-
bioRxiv - Developmental Biology 2024Quote: Polyclonal antibodies against Spar (CG4577) were custom generated in guinea pigs by Eurogentec. Two Spar peptides corresponding to epitopes LQEIDDYVPERRVSS (amino acids 212-226 ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Microbiology 2023Quote: ... the anti-KhpB was generated with a synthesized peptide derived from C- terminus of KhpB protein (H-CGRDPKRYIVIKKKRG-OH) in rabbits (Eurogentec). The KhpB anti- serum was tested with ELISA assay and further cleaned with affinity purification ...
-
bioRxiv - Microbiology 2023Quote: Polyclonal antisera against ComG pilins were produced by immunising rabbits with a mixture of two different peptides that were synthesised from each protein (Eurogentec). Peptides corresponding to the following residues in mature pilins were used ...
-
bioRxiv - Plant Biology 2020Quote: ... WOX9 peptide antibodies used for ChIP assays were synthesized by Eurogentec (https://www.eurogentec.com/en/) using amino acid sequences specific for SRB homolog Phvul.006G179900 and SB homolog Glyma.11G210800 (Fig ...
-
bioRxiv - Neuroscience 2023Quote: Zebrafish peptide specific antibodies were generated in an 87-day classical program by Eurogentec S.A ...
-
bioRxiv - Plant Biology 2019Quote: ... Anti-5-methylcytosine (Eurogentec BI-MECY-0100, lot: vt150601) or anti-H3K9me2 (Abcam ab1220 ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mg of the peptide was coupled with the carrier protein KHL (Keyhole Limpet Hemocyanin) and was subsequently used to inoculate a rabbit (through the Eurogentec’s speedy program) for antibody production ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Cell Biology 2020Quote: ... The anti-M6 antiserum was generated by immunizing guinea pigs (Eurogentec) with the peptides RRNSYRSDHSLDRYT and NLNELEYSATSKDRF (corresponding to aa 102-116 and 354-368 in M6 isoform F ...
-
bioRxiv - Plant Biology 2019Quote: ... NAR2.1 was detected using one anti-NAR2.1 antisera produced by Eurogentec against the synthetic peptide DVTTKPSREGPGVVL (anti-NAR2.1) ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... A guinea pig antibody was then raised against the purified peptide by Eurogentec (Kaneka Eurogentec S.A., Belgium). Finally ...
-
bioRxiv - Plant Biology 2019Quote: ... NRT2.1 was detected using three different anti-NRT2.1 antisera produced by Eurogentec against either the synthetic peptide TLEKAGEVAKDKFGK (anti-NRT2.1 19) ...
-
bioRxiv - Cell Biology 2023Quote: The anti-M6 antiserum #2 was generated by immunizing guinea pigs (Eurogentec) with the peptides GKGNNRDRIRDPRE and RRNSYRSDHSLDRYT (corresponding to aa 57–71 and 102–116 in M6 isoform F ...