Labshake search
Citations for Eurogentec :
101 - 150 of 165 citations for Rabbit Anti Borrelia burgdorferi sensu stricto B31 VlsE Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Zoology 2020Quote: ... They were raised in rabbits using the speedy protocol from Eurogentec (Seraing, Belgium) and purified against the same peptide before using for immunofluorescence at 1:200.
-
bioRxiv - Plant Biology 2019Quote: ... The purified recombinant protein was used to immunize rabbits by a company (Eurogentec). From the immunserum a crude IgG fraction was isolated by ammonium sulfate precipitation then IgG was further purified on protein gel blots of the antigen ...
-
bioRxiv - Plant Biology 2020Quote: ... synthetic peptides (Fig. S9) were used for rabbit immunization and affinity chromatography (Eurogentec). For assessing the specificity and cross-reaction of the antibodies ...
-
bioRxiv - Biochemistry 2021Quote: ... The polyclonal TbUbL1 rabbit antisera used for immunoblots was produced commercially by Eurogentec using peptide sequence CSEISGNHRSSEHNAG ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody was produced by Eurogentec (Seraing, Belgium).
-
bioRxiv - Evolutionary Biology 2021Quote: ... lobularis were obtained by immunizing rabbits using the speedy protocol from Eurogentec (Seraing, Belgium) with a synthetic peptide (QTISDPGEEDPPVSKC ...
-
bioRxiv - Microbiology 2020Quote: ... Primary antibodies against Hcp (Eurogentec; Metzger et al., 2016) were used at 1:5,000 dilution while anti-Sigma70-HRP antibodies (BioLegend ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...
-
bioRxiv - Genomics 2020Quote: ... A commercial monoclonal antibody against 5-methylcytidine from Eurogentec was used for immunoprecipitation ...
-
bioRxiv - Cell Biology 2021Quote: ... Polyclonal antibodies were raised against the fusion protein (Eurogentec). Immuno-reactive complexes were detected using horseradish-peroxidase coupled anti-rabbit or anti-mouse antibodies (Sigma-Aldrich/Merck ...
-
bioRxiv - Molecular Biology 2019Quote: ... Pab-DnaG or Pab-aCPSF1 (custom polyclonal antibodies, Eurogentec) diluted 10,000-fold and an anti-rabbit IgG HRP conjugate (Promega ...
-
bioRxiv - Developmental Biology 2022Quote: ... Antibodies were raised in two guinea pigs by Eurogentec.
-
bioRxiv - Microbiology 2021Quote: Rabbits were immunized with recombinant ACS according to the manufacturer’s standard procedures (Eurogentec, Seraing, Belgium). Reactivity of serum was compared to pre-immune serum using an enzyme-linked immunosorbent assay ...
-
bioRxiv - Plant Biology 2020Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Plant Biology 2022Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-BBX22(199–213) (Eurogentec, raised in rabbits against the peptide C+DQSYEYMENNGSSKT and affinity purified) ...
-
bioRxiv - Cell Biology 2023Quote: Purified recombinant TbSmee1(1-400) was used for the generation of two polyclonal rabbit antisera (Eurogentec). Antisera (303 ...
-
bioRxiv - Cell Biology 2020Quote: ... or pHH3 ser10 (custom antibody to peptide ARTKQTARKS*TGGKAPRKQLASK: Eurogentec) overnight at 4°C ...
-
bioRxiv - Microbiology 2021Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody using an ImageQuant LAS 4000 mini digital imaging system (GE Healthcare) ...
-
bioRxiv - Cancer Biology 2022Quote: ... HPV-16 E7 pS31/S32 peptide antibody generated by Eurogentec has been described previously [12] ...
-
bioRxiv - Biochemistry 2021Quote: ... The antibody was affinity purified against the antigen by Eurogentec, and used at a 1:50 dilution ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti- rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Proteins were probed via α-DnaD polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Developmental Biology 2019Quote: ... The antibody was produced in guinea pigs by Eurogentec (Liège, Belgium).
-
bioRxiv - Microbiology 2021Quote: ... Gel portions containing CcrZ was sent for antibody production by Eurogentec.
-
bioRxiv - Microbiology 2020Quote: ... Purified CexE protein was used to produce primary antibodies by Eurogentec using the 28-day speedy protocol ...
-
bioRxiv - Cell Biology 2023Quote: A custom polyclonal antibody to RAB18 generated by Eurogentec (Southampton, UK) has been described previously (10) ...
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Neuroscience 2023Quote: ... The synthetic peptide was conjugated to keyhole limpet hemocyanin for immunization of rabbits and guinea pigs (Eurogentec, Belgium). Resulting sera were affinity-purified on the peptide antigen and the specificity of the resulting antibodies was confirmed using lysates and tissue sections from Rbm20 knock-out mice.
-
bioRxiv - Microbiology 2020Quote: ... and those with Hcp pooled and used to generate polyclonal antibodies (EuroGentec).
-
bioRxiv - Cell Biology 2023Quote: ... A third polyclonal antibody (508) was generated against two TbSmee1 peptides (Eurogentec) and affinity purified using the peptide antigens immobilised on a Sulfolink affinity column (ThermoFisher) ...
-
bioRxiv - Developmental Biology 2019Quote: ... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Neuroscience 2019Quote: The custom-made CNK2 antibody used in this study was produced by Eurogentec. It was raised in guinea pig against a KHL-conjugated peptide representing CNK2 amino-acids 727-741 and affinity matrix purified ...
-
bioRxiv - Molecular Biology 2019Quote: ... a polyclonal exWAGO antibody was used (generated and purified against peptides TKQTKDDFPEQERK, Eurogentec) overnight at 4°C ...
-
bioRxiv - Developmental Biology 2024Quote: Polyclonal antibodies against Spar (CG4577) were custom generated in guinea pigs by Eurogentec. Two Spar peptides corresponding to epitopes LQEIDDYVPERRVSS (amino acids 212-226 ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Microbiology 2023Quote: ... the anti-KhpB was generated with a synthesized peptide derived from C- terminus of KhpB protein (H-CGRDPKRYIVIKKKRG-OH) in rabbits (Eurogentec). The KhpB anti- serum was tested with ELISA assay and further cleaned with affinity purification ...
-
bioRxiv - Microbiology 2023Quote: Polyclonal antisera against ComG pilins were produced by immunising rabbits with a mixture of two different peptides that were synthesised from each protein (Eurogentec). Peptides corresponding to the following residues in mature pilins were used ...
-
bioRxiv - Plant Biology 2020Quote: ... WOX9 peptide antibodies used for ChIP assays were synthesized by Eurogentec (https://www.eurogentec.com/en/) using amino acid sequences specific for SRB homolog Phvul.006G179900 and SB homolog Glyma.11G210800 (Fig ...
-
bioRxiv - Neuroscience 2023Quote: Zebrafish peptide specific antibodies were generated in an 87-day classical program by Eurogentec S.A ...
-
bioRxiv - Plant Biology 2019Quote: ... Anti-5-methylcytosine (Eurogentec BI-MECY-0100, lot: vt150601) or anti-H3K9me2 (Abcam ab1220 ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mg of the peptide was coupled with the carrier protein KHL (Keyhole Limpet Hemocyanin) and was subsequently used to inoculate a rabbit (through the Eurogentec’s speedy program) for antibody production ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Cell Biology 2020Quote: ... The anti-M6 antiserum was generated by immunizing guinea pigs (Eurogentec) with the peptides RRNSYRSDHSLDRYT and NLNELEYSATSKDRF (corresponding to aa 102-116 and 354-368 in M6 isoform F ...
-
bioRxiv - Plant Biology 2019Quote: ... NAR2.1 was detected using one anti-NAR2.1 antisera produced by Eurogentec against the synthetic peptide DVTTKPSREGPGVVL (anti-NAR2.1) ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... A guinea pig antibody was then raised against the purified peptide by Eurogentec (Kaneka Eurogentec S.A., Belgium). Finally ...
-
bioRxiv - Plant Biology 2019Quote: ... NRT2.1 was detected using three different anti-NRT2.1 antisera produced by Eurogentec against either the synthetic peptide TLEKAGEVAKDKFGK (anti-NRT2.1 19) ...
-
bioRxiv - Cell Biology 2023Quote: The anti-M6 antiserum #2 was generated by immunizing guinea pigs (Eurogentec) with the peptides GKGNNRDRIRDPRE and RRNSYRSDHSLDRYT (corresponding to aa 57–71 and 102–116 in M6 isoform F ...