Labshake search
Citations for Eurogentec :
1 - 50 of 109 citations for Mouse Anti Human Immunodeficiency Virus HIV 1 p17 1981 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2020Quote: ... 1.25 µl of mouse anti-human 5mC antibody (clone 33D3; Eurogentec Ltd., Cat No. BI-MECY, RRID:AB_2616058), and 10 µl of Dynabeads coupled with M-280 sheep anti-mouse IgG bead (Invitrogen) ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Cancer Biology 2022Quote: ... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
bioRxiv - Genomics 2019Quote: ... 0.05% Triton X-100) using 1 µl of mouse monoclonal anti-5-methylcytosine antibody (Eurogentec BI-MECY-0100) or 0,5 µl of rabbit 5-Hydroxymethylcytosine antibody (Active motif 39769) ...
-
bioRxiv - Cell Biology 2021Quote: ... and washed with PBS before blocking and primary antibody incubation (mouse-anti 5-methycytosine, Eurogentec, BI-MECY-0100, 1:250). After PBS washes ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Molecular Biology 2022Quote: ... Anti-DHX34 is a peptide-specific antibody raised against human DHX34 obtained from Eurogentec (Hug and Cáceres 2014). For Immunopurifications GFP-Trap-MA beads (Chromotek ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Neuroscience 2020Quote: ... and rabbit anti-neurofilament antibodies (Eurogentec, 1/50) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-FPN antibody (1:2,000, Eurogentec, NRU 451443), rabbit anti-FTH (1:500 ...
-
bioRxiv - Microbiology 2019Quote: ... Anti-OmpA antibody54 was used at 1:20,000 and a custom anti-TssL antibody (Eurogentec; see Supplementary Fig. 8) was used at 1:6,000 ...
-
bioRxiv - Microbiology 2022Quote: ... The membrane was blocked with PBS + 5% milk for 1 hour at room temperature then incubated with a PBS + 1% milk solution containing a 1:2000 polyclonal anti-DnaA antibody (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...
-
Cultivation and characterization of human midbrain organoids in sensor integrated microfluidic chipsbioRxiv - Bioengineering 2019Quote: ... The following first antibodies were used: anti-rabbit Tuj1 (Optim AB Eurogentec, 1:600); anti-rabbit TH (SantaCruz ...
-
bioRxiv - Microbiology 2023Quote: ... Native ΦKZ014 in infected cells was detected by Western blot (1:10k anti-ΦKZ014, Eurogentec, #1661 ...
-
bioRxiv - Molecular Biology 2020Quote: ... immunostaining Q22YU3Δ/SHULINΔ cells with a custom polyclonal anti-body against Shulin (Eurogentec, 1:100 dilution) confirmed loss of protein as well as serving as antibody validation (Figure S12C ...
-
bioRxiv - Biochemistry 2022Quote: ... the reaction was probed using the following antibodies: custom-made rabbit anti-Sch9-pSer288 (Eurogentec, 1:4’000), and goat anti-Sch9 (GenScript ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-non-muscle myosin heavy chain II-A (NMIIA) (1:1000; PRB-440P-050, Eurogentec, Liege, Belgium), mouse anti-α-actinin (1:800 ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-DnaD and anti- DnaB antibodies (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-DnaD and anti-DnaB antibodies (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Biochemistry 2024Quote: ... Fractions were analysed by Western blotting using a 1/10,000 dilution of primary rabbit anti-FLAG® antibodies (Eurogentec) followed by a 1/5000 dilution of secondary donkey anti-rabbit IgG conjugated to HRP (Santa Cruz biotechnology ...
-
bioRxiv - Cell Biology 2022Quote: ... with 5% non-fat dry milk for 30 min and incubated with anti-HA primary antibody (1:5,000, Eurogentec 16B12) or anti-Pgk1 primary antibody (1:5,000 ...
-
bioRxiv - Neuroscience 2020Quote: Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin (Eurogentec, 1/50) and rabbit anti-neurofilament antibodies (Eurogentec ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Molecular Biology 2022Quote: ... membranes were blocked in 5% milk PBS-T (1X PBS buffer with 0.1% Tween-20) and incubated overnight at 4°C with one of the following antibodies: anti-HA.11 (1:2,000; Eurogentec, Cat# MMS-101P-500), anti-Stm1 (1:10,000 ...
-
bioRxiv - Neuroscience 2023Quote: ... Guinea pig anti-EAAT5b and rabbit anti-EAAT7 antibodies were column purified by Eurogentec.
-
bioRxiv - Cell Biology 2023Quote: ... Custom rabbit pAb anti-pS62 and anti-pT61-pS62 NDC80 were raised by Eurogentec using a 28-day protocol ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-BBX22(199–213) (Eurogentec, raised in rabbits against the peptide C+DQSYEYMENNGSSKT and affinity purified) ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Neuroscience 2019Quote: ... Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin and rabbit anti-neurofilament antibodies (Eurogentec) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Cell Biology 2021Quote: ... 2Y4824 rabbit anti-pre-immune serum (PIS; Eurogentec) was used for control purposes ...
-
bioRxiv - Molecular Biology 2022Quote: ... because detection via our anti-DnaD antibody (Eurogentec) was not fully consistent between wild-type and variant alleles of dnaD ...
-
bioRxiv - Developmental Biology 2023Quote: ... 1.25μg anti-5mC antibody (Eurogentec BI-MECY-0100) and 10μL Dynabeads coupled with M-280 sheep anti-mouse antibody (Invitrogen) ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinitiesbioRxiv - Biochemistry 2019Quote: ... HA tagged proteins were labeled overnight at 4°C with the mouse HA.11 Clone 16B12 Monoclonal Antibody (Eurogentec) 1/2000 in PBS + tween 0.2% (v/v ...
-
bioRxiv - Physiology 2023Quote: MMP2 and 9 activity assays were used to measure MMP2 and 9 activities in frozen mouse heart tissue and plasma following the manufacturer’s instructions (AS-72017, Eurogentec). MMP9 activity in conditioned media from human ciCMVEC was also assessed.
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Microbiology 2019Quote: ... Polyclonal Anti-Rv3852 antibody was produced by Eurogentec (30).
-
bioRxiv - Plant Biology 2019Quote: ... Anti-5-methylcytosine (Eurogentec BI-MECY-0100, lot: vt150601) or anti-H3K9me2 (Abcam ab1220 ...
-
bioRxiv - Neuroscience 2019Quote: Primary antibodies: anti-CNK2 (guinea pig, Eurogentec, custom-made), anti-CNK2 (rabbit ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti Am TIG1 antibodies were manufactured by Eurogentec, by raising rabbit antisera against two non-overlapping peptides corresponding to residues MAQVKSVKQRLRND (154 ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A polyclonal anti-rabbit (custom-made by Eurogentec, Seraing, Belgium), PEVK polyclonal anti-rabbit (Myomedix ...
-
bioRxiv - Cell Biology 2020Quote: Anti-TMEM70 antibodies were rabbit polyclonal sera raised by Eurogentec SA (Belgium ...
-
bioRxiv - Neuroscience 2022Quote: ... Rabbit anti-Mmt (Eurogentec, generated in this study, see below); and Mouse anti-NC82 (nc82 was deposited to the DSHB by Buchner ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Cell Biology 2020Quote: ... The anti-M6 antiserum was generated by immunizing guinea pigs (Eurogentec) with the peptides RRNSYRSDHSLDRYT and NLNELEYSATSKDRF (corresponding to aa 102-116 and 354-368 in M6 isoform F ...