Labshake search
Citations for Eurogentec :
51 - 100 of 160 citations for Mouse Anti Dengue Virus Envelope Protein Serotypes 1 3 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2020Quote: ... or 500 ng to 3 µg for integrative plasmids (MicroPulserTM electroporator Biorad in 2 mm cuvettes (Eurogentec) at 25 µF ...
-
bioRxiv - Microbiology 2023Quote: ... For HuR knockdown experiment we transfected 150nM of either DsiHuR: 5’AUUUCUGAAUCUGUGACGCAAGAAT 3’(IDT) or Nonspecific (Eurogentec) siRNA 24 hrs prior to luciferase construct transfection.
-
bioRxiv - Plant Biology 2019Quote: ... The purified recombinant protein was used to immunize rabbits by a company (Eurogentec). From the immunserum a crude IgG fraction was isolated by ammonium sulfate precipitation then IgG was further purified on protein gel blots of the antigen ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Developmental Biology 2020Quote: ... Non-targeting control siRNA and siRNA duplexes targeting Sorbs1 (5’-UUAAGUCCUGAGUGCUCUUC-3’) were synthesized and purchased from Eurogentec.
-
bioRxiv - Cell Biology 2023Quote: ... CD79α and glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was measured by RT-qPCR using Takyon SYBR Master Mix (Eurogentec), 100nM of specific primers ...
-
bioRxiv - Molecular Biology 2022Quote: ... membranes were blocked in 5% milk PBS-T (1X PBS buffer with 0.1% Tween-20) and incubated overnight at 4°C with one of the following antibodies: anti-HA.11 (1:2,000; Eurogentec, Cat# MMS-101P-500), anti-Stm1 (1:10,000 ...
-
bioRxiv - Molecular Biology 2023Quote: ... 0.3 mg of protein was used per rabbit for immunization of 2 rabbits (Eurogentec). Serum collected from one rabbit was affinity purified against GST-ATI11-180 ...
-
bioRxiv - Cell Biology 2021Quote: ... 2015b) directly labeled with a fluorophore in 3’ end (sequences are detailed in Table S1) were purchased from Eurogentec. These probes located (Fig ...
-
bioRxiv - Neuroscience 2023Quote: ... Guinea pig anti-EAAT5b and rabbit anti-EAAT7 antibodies were column purified by Eurogentec.
-
bioRxiv - Cell Biology 2023Quote: ... Custom rabbit pAb anti-pS62 and anti-pT61-pS62 NDC80 were raised by Eurogentec using a 28-day protocol ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-BBX22(199–213) (Eurogentec, raised in rabbits against the peptide C+DQSYEYMENNGSSKT and affinity purified) ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti-uL11K3me3 antibodies were generated in rabbit using a peptide corresponding to the first 16 amino acids of uL11 with methylated lysine 3 [PPK(me3)FDPTEVKLVYLRC] (Eurogentec). The serum was first loaded on a uL11K3me3 peptide affinity column which allowed to retain anti-uL11K3me3 and anti-uL11 antibodies ...
-
bioRxiv - Immunology 2021Quote: Immunising and screening peptides are outlined in S.Table 2 (Figure 3-figure supplement 2) and were synthesized by Eurogentec (Belgium). A portion was further conjugated to Key Lymphocyte Haemoglutinin (KLH ...
-
bioRxiv - Microbiology 2022Quote: ... 0.8 mg protein was used for raising two antibodies against KhpB in rabbit (Eurogentec, speedy program).
-
bioRxiv - Microbiology 2023Quote: Antibodies against BacA were raised by immunization of rabbits with purified BacA-His6 protein (Eurogentec, Belgium). Cells were harvested in the exponential growth phase ...
-
bioRxiv - Neuroscience 2021Quote: ... aiming to skip DMD exon 51 (51-[T*C*A*A*G*G*A*A*G*A*T*G*G*C*A*T*T*T*C*T]-3⍰, Eurogentec, Belgium) by transfection with Lipofectamine as described in43,44 and analysed by either myoblot (96 well plates ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Biochemistry 2022Quote: Purified Fz4CRD-Connector and Fz7CRD proteins were incubated with a palmitoleoylated peptide (Wnt7a residues 202-209; Eurogentec)12 at a molar ratio of 1:1.25 overnight at 4°C in a buffer containing 10 mM HEPES ...
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Microbiology 2023Quote: ... a 20 µl mixture containing 3 µl of RNA was prepared using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Developmental Biology 2019Quote: ... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
bioRxiv - Neuroscience 2019Quote: ... Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin and rabbit anti-neurofilament antibodies (Eurogentec) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Cell Biology 2021Quote: ... 2Y4824 rabbit anti-pre-immune serum (PIS; Eurogentec) was used for control purposes ...
-
bioRxiv - Molecular Biology 2022Quote: ... because detection via our anti-DnaD antibody (Eurogentec) was not fully consistent between wild-type and variant alleles of dnaD ...
-
bioRxiv - Developmental Biology 2023Quote: ... 1.25μg anti-5mC antibody (Eurogentec BI-MECY-0100) and 10μL Dynabeads coupled with M-280 sheep anti-mouse antibody (Invitrogen) ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Physiology 2023Quote: MMP2 and 9 activity assays were used to measure MMP2 and 9 activities in frozen mouse heart tissue and plasma following the manufacturer’s instructions (AS-72017, Eurogentec). MMP9 activity in conditioned media from human ciCMVEC was also assessed.
-
bioRxiv - Neuroscience 2020Quote: ... was induced in 8-week-old female SJL/J mice via subcutaneous immunization with 200 μg recombinant myelin proteolipid protein (PLP139-151, Eurogentec) in an emulsion mix (volume ratio 1:1 ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... The purified recombinant protein was then used as an antigen in an 87 days immunization program on Guinea pigs (outsourced to Eurogentec). The DMC1 antibody was then purified from antisera following affinity purification (using Affi-Gel 15 from Biorad ...
-
bioRxiv - Microbiology 2023Quote: ... the anti-KhpB was generated with a synthesized peptide derived from C- terminus of KhpB protein (H-CGRDPKRYIVIKKKRG-OH) in rabbits (Eurogentec). The KhpB anti- serum was tested with ELISA assay and further cleaned with affinity purification ...
-
bioRxiv - Microbiology 2023Quote: Polyclonal antisera against ComG pilins were produced by immunising rabbits with a mixture of two different peptides that were synthesised from each protein (Eurogentec). Peptides corresponding to the following residues in mature pilins were used ...
-
bioRxiv - Cell Biology 2023Quote: Recombinant full-size proteins were used to immunise different animals (Pineda, Berlin, Germany; Davids Biotechnology, Regensburg, Germany; Eurogentec, Seraing, Belgium). The resulting antisera were affinity purified against the immobilised recombinant protein ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Microbiology 2019Quote: ... Polyclonal Anti-Rv3852 antibody was produced by Eurogentec (30).
-
bioRxiv - Plant Biology 2019Quote: ... Anti-5-methylcytosine (Eurogentec BI-MECY-0100, lot: vt150601) or anti-H3K9me2 (Abcam ab1220 ...
-
bioRxiv - Neuroscience 2019Quote: Primary antibodies: anti-CNK2 (guinea pig, Eurogentec, custom-made), anti-CNK2 (rabbit ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti Am TIG1 antibodies were manufactured by Eurogentec, by raising rabbit antisera against two non-overlapping peptides corresponding to residues MAQVKSVKQRLRND (154 ...
-
bioRxiv - Plant Biology 2021Quote: A solution containing 3.5 mg of purified recombinant LbGH28A protein was used to elicit the production of polyclonal antibodies in rabbit according to the manufacturer’s procedure (Eurogentec, Seraing, Belgium). The indirect immunofluorescent (IIF ...
-
bioRxiv - Microbiology 2022Quote: ... negevensis [62,63] and antibodies targeting NlpC of each bacterium (produced by immunization of mice with the purified proteins, Eurogentec, Seraing, Belgium). A subsequent incubation with secondary antibodies Alexa Fluor 488 goat anti-mouse and Alexa Fluor 594 donkey anti-rabbit (Thermo FisherScientific ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mg of the peptide was coupled with the carrier protein KHL (Keyhole Limpet Hemocyanin) and was subsequently used to inoculate a rabbit (through the Eurogentec’s speedy program) for antibody production ...
-
bioRxiv - Microbiology 2022Quote: ... A region of 168 base pairs on the PB2 protein was amplified by RT-PCR using custom primers (Table S6)(Eurogentec, Maastricht, Netherlands) and the QIAGEN OneStep RT-PCR Kit (Qiagen ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A polyclonal anti-rabbit (custom-made by Eurogentec, Seraing, Belgium), PEVK polyclonal anti-rabbit (Myomedix ...
-
bioRxiv - Cell Biology 2020Quote: Anti-TMEM70 antibodies were rabbit polyclonal sera raised by Eurogentec SA (Belgium ...
-
bioRxiv - Neuroscience 2022Quote: ... Rabbit anti-Mmt (Eurogentec, generated in this study, see below); and Mouse anti-NC82 (nc82 was deposited to the DSHB by Buchner ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Cell Biology 2020Quote: ... The anti-M6 antiserum was generated by immunizing guinea pigs (Eurogentec) with the peptides RRNSYRSDHSLDRYT and NLNELEYSATSKDRF (corresponding to aa 102-116 and 354-368 in M6 isoform F ...
-
bioRxiv - Plant Biology 2019Quote: ... NAR2.1 was detected using one anti-NAR2.1 antisera produced by Eurogentec against the synthetic peptide DVTTKPSREGPGVVL (anti-NAR2.1) ...