Labshake search
Citations for Eurogentec :
1 - 50 of 141 citations for Human Oxidation resistance protein 1 OXR1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2022Quote: ... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
bioRxiv - Genetics 2019Quote: ... and the resulting immune antisera were tested against the recombinant antigen by ELISA (Eurogentec), and the endogenous protein in mouse testes from WT and KO mice (data not shown) ...
-
bioRxiv - Molecular Biology 2024Quote: A poly(GP) Meso Scale Discovery (MSD®) enzyme-linked immunosorbent assay (ELISA) was established using a custom made rabbit αLGP antibody (Eurogentec) and based on previously described methods16 ...
-
bioRxiv - Cell Biology 2021Quote: ... Polyclonal antibodies were raised against the fusion protein (Eurogentec). Immuno-reactive complexes were detected using horseradish-peroxidase coupled anti-rabbit or anti-mouse antibodies (Sigma-Aldrich/Merck ...
-
bioRxiv - Microbiology 2023Quote: ... and subsequently affinity-purified against GST-YgfB protein (Eurogentec).
-
bioRxiv - Molecular Biology 2019Quote: ... The proteins were resolved on 8% iD PAGE GELS (Eurogentec), transferred onto nitrocellulose membrane (Amersham) ...
-
bioRxiv - Molecular Biology 2022Quote: ... Proteins were probed via α-DnaD polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Genomics 2020Quote: ... 1.25 µl of mouse anti-human 5mC antibody (clone 33D3; Eurogentec Ltd., Cat No. BI-MECY, RRID:AB_2616058), and 10 µl of Dynabeads coupled with M-280 sheep anti-mouse IgG bead (Invitrogen) ...
-
bioRxiv - Genetics 2019Quote: ... The purified protein was used to immunize 2 rabbits (Eurogentec, Belgium), and the resulting immune antisera were tested against the recombinant antigen by ELISA (Eurogentec) ...
-
bioRxiv - Developmental Biology 2022Quote: ... Purified protein was shipped for antibody production (custom polyclonal antibodies, Eurogentec). Rabbit polyclonal anti-Shp1 was purified in house by affinity purification ...
-
bioRxiv - Microbiology 2020Quote: ... Purified CexE protein was used to produce primary antibodies by Eurogentec using the 28-day speedy protocol ...
-
bioRxiv - Molecular Biology 2022Quote: ... Anti-DHX34 is a peptide-specific antibody raised against human DHX34 obtained from Eurogentec (Hug and Cáceres 2014). For Immunopurifications GFP-Trap-MA beads (Chromotek ...
-
bioRxiv - Plant Biology 2019Quote: ... The purified recombinant protein was used to immunize rabbits by a company (Eurogentec). From the immunserum a crude IgG fraction was isolated by ammonium sulfate precipitation then IgG was further purified on protein gel blots of the antigen ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Molecular Biology 2023Quote: ... 0.3 mg of protein was used per rabbit for immunization of 2 rabbits (Eurogentec). Serum collected from one rabbit was affinity purified against GST-ATI11-180 ...
-
bioRxiv - Microbiology 2022Quote: ... 0.8 mg protein was used for raising two antibodies against KhpB in rabbit (Eurogentec, speedy program).
-
bioRxiv - Microbiology 2023Quote: Antibodies against BacA were raised by immunization of rabbits with purified BacA-His6 protein (Eurogentec, Belgium). Cells were harvested in the exponential growth phase ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Biochemistry 2022Quote: Purified Fz4CRD-Connector and Fz7CRD proteins were incubated with a palmitoleoylated peptide (Wnt7a residues 202-209; Eurogentec)12 at a molar ratio of 1:1.25 overnight at 4°C in a buffer containing 10 mM HEPES ...
-
bioRxiv - Molecular Biology 2021Quote: ... random nonamers (Eurogentec Reverse Transcriptase Core Kit) was used to prepare cDNA by using the 200 ng of the total RNA for 10 μl of reaction and the produced cDNA was used for comparative quantitation of mRNA expression ...
-
bioRxiv - Cell Biology 2020Quote: A PLA kit II (Eurogentec, Seraing, BE) was used according to the manufacturer’s instructions with slight modifications ...
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Molecular Biology 2020Quote: ... mRNA real time quantification was generally performed in a two step format using Eurogentec Reverse Transcriptase Core Kit and MESA GREEN qPCR Master Mix Plus for SYBR Assay with Low Rox kit from Eurogentec following the suppliers’ protocols ...
-
bioRxiv - Cancer Biology 2021Quote: ... mRNA real time quantification was generally performed in a two step format using Eurogentec Reverse Transcriptase Core Kit and MESA GREEN qPCR Master Mix Plus for SYBR Assay with Low Rox kit from Eurogentec following the suppliers’ protocols ...
-
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinitiesbioRxiv - Biochemistry 2019Quote: ... HA tagged proteins were labeled overnight at 4°C with the mouse HA.11 Clone 16B12 Monoclonal Antibody (Eurogentec) 1/2000 in PBS + tween 0.2% (v/v ...
-
bioRxiv - Developmental Biology 2019Quote: ... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Plant Biology 2020Quote: ... For qPCR a SYBR Green core qPCR kit (Eurogentec) and a StepOnePlus machine (ThermoFisher ...
-
bioRxiv - Cell Biology 2020Quote: ... using MESA BLUE qPCR kit for SYBR assay (Eurogentec) according to the manufacturer’s instructions with primers for 18S (see Table 1 ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... using the SYBR Green I qPCR core kit (Eurogentec). Thermal conditions were 50°C for 2 minutes ...
-
bioRxiv - Plant Biology 2020Quote: ... We used Takyon qPCR Kit for SYBER assay (Eurogentec) and the RT-PCR was carried out in CFX96 Touch Real-Time PCR Detection System (Bio-Rad) ...
-
bioRxiv - Microbiology 2022Quote: ... using MESA BLUE qPCR kit for SYBR assay (Eurogentec) according to the manufacturer’s instructions with primers for 18S (see Table 1 ...
-
bioRxiv - Genetics 2023Quote: ... and then a Takyon SYBR Green PCR kit (Eurogentec) in a StepOnePlus apparatus (Applied Biosystems ...
-
bioRxiv - Neuroscience 2023Quote: ... Takyon ROX SYBR Master Mix blue dTTP Kit (Eurogentec) was used ...
-
bioRxiv - Neuroscience 2020Quote: ... was induced in 8-week-old female SJL/J mice via subcutaneous immunization with 200 μg recombinant myelin proteolipid protein (PLP139-151, Eurogentec) in an emulsion mix (volume ratio 1:1 ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... The purified recombinant protein was then used as an antigen in an 87 days immunization program on Guinea pigs (outsourced to Eurogentec). The DMC1 antibody was then purified from antisera following affinity purification (using Affi-Gel 15 from Biorad ...
-
bioRxiv - Microbiology 2023Quote: ... the anti-KhpB was generated with a synthesized peptide derived from C- terminus of KhpB protein (H-CGRDPKRYIVIKKKRG-OH) in rabbits (Eurogentec). The KhpB anti- serum was tested with ELISA assay and further cleaned with affinity purification ...
-
bioRxiv - Microbiology 2023Quote: Polyclonal antisera against ComG pilins were produced by immunising rabbits with a mixture of two different peptides that were synthesised from each protein (Eurogentec). Peptides corresponding to the following residues in mature pilins were used ...
-
bioRxiv - Cell Biology 2023Quote: Recombinant full-size proteins were used to immunise different animals (Pineda, Berlin, Germany; Davids Biotechnology, Regensburg, Germany; Eurogentec, Seraing, Belgium). The resulting antisera were affinity purified against the immobilised recombinant protein ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Plant Biology 2021Quote: A solution containing 3.5 mg of purified recombinant LbGH28A protein was used to elicit the production of polyclonal antibodies in rabbit according to the manufacturer’s procedure (Eurogentec, Seraing, Belgium). The indirect immunofluorescent (IIF ...
-
bioRxiv - Microbiology 2022Quote: ... negevensis [62,63] and antibodies targeting NlpC of each bacterium (produced by immunization of mice with the purified proteins, Eurogentec, Seraing, Belgium). A subsequent incubation with secondary antibodies Alexa Fluor 488 goat anti-mouse and Alexa Fluor 594 donkey anti-rabbit (Thermo FisherScientific ...
-
bioRxiv - Pathology 2021Quote: ... Reverse transcription was performed using Reverse Transcriptase Core Kit (Eurogentec). qRT-PCR were performed on a LightCycler 480 instrument (Roche ...
-
bioRxiv - Plant Biology 2022Quote: ... 30 s) using Takyon qPCR kit for SYBR assay (Eurogentec) (2.5 µL TAKYON SYBER 2X ...
-
bioRxiv - Physiology 2024Quote: ... and reverse transcribed with the Reverse Transcriptase Core kit (Eurogentec). Gene expression was analyzed by quantitative real-time PCR (qRT-PCR ...
-
bioRxiv - Microbiology 2019Quote: An MHC I class-restricted peptide from YFV-17D non-structural protein 3 (NS3) (sequence ATLTYRML) (57) was synthetized by Eurogentec (Seraing, Belgium). Total cellular antigen for YFV-17D and JEV SA14-14-2 was prepared first by infecting Vero E6 cells with 0.1 MOI YFV-17D or JEV SA14-14-2 ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mg of the peptide was coupled with the carrier protein KHL (Keyhole Limpet Hemocyanin) and was subsequently used to inoculate a rabbit (through the Eurogentec’s speedy program) for antibody production ...
-
bioRxiv - Microbiology 2022Quote: ... A region of 168 base pairs on the PB2 protein was amplified by RT-PCR using custom primers (Table S6)(Eurogentec, Maastricht, Netherlands) and the QIAGEN OneStep RT-PCR Kit (Qiagen ...
-
bioRxiv - Systems Biology 2021Quote: ... mRNA was reverse transcribed using the Reverse Transcriptase Core kit (Eurogentec). In order to reduce variability in mRNA input ...