Labshake search
Citations for Eurogentec :
1 - 50 of 100 citations for Dengue Virus NS1 Protein Serotypes 1 4 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinitiesbioRxiv - Biochemistry 2019Quote: ... HA tagged proteins were labeled overnight at 4°C with the mouse HA.11 Clone 16B12 Monoclonal Antibody (Eurogentec) 1/2000 in PBS + tween 0.2% (v/v ...
-
bioRxiv - Physiology 2023Quote: ... Fluorescein-Trp25-Exendin-4 (FLEX; Eurogentec; 0.5μg/μL), Exendin-9 (Ex9 ...
-
bioRxiv - Molecular Biology 2022Quote: ... membranes were blocked in 5% milk PBS-T (1X PBS buffer with 0.1% Tween-20) and incubated overnight at 4°C with one of the following antibodies: anti-HA.11 (1:2,000; Eurogentec, Cat# MMS-101P-500), anti-Stm1 (1:10,000 ...
-
bioRxiv - Molecular Biology 2020Quote: ... in cuvettes with a 4-mm inter-electrode distance (Eurogentec). Transfected cells were grown for 48 h in the presence of 7 µM ouabain (Sigma ...
-
bioRxiv - Cell Biology 2021Quote: ... Polyclonal antibodies were raised against the fusion protein (Eurogentec). Immuno-reactive complexes were detected using horseradish-peroxidase coupled anti-rabbit or anti-mouse antibodies (Sigma-Aldrich/Merck ...
-
bioRxiv - Microbiology 2023Quote: ... and subsequently affinity-purified against GST-YgfB protein (Eurogentec).
-
bioRxiv - Molecular Biology 2019Quote: ... The proteins were resolved on 8% iD PAGE GELS (Eurogentec), transferred onto nitrocellulose membrane (Amersham) ...
-
bioRxiv - Molecular Biology 2022Quote: ... Proteins were probed via α-DnaD polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Cancer Biology 2023Quote: ... Primers were purchased from Qiagen (miScript Primer Assay range) and from Eurogentec (primer list Supp. Table 4) to respectively amplify miRNA and mRNA ...
-
bioRxiv - Genetics 2019Quote: ... The purified protein was used to immunize 2 rabbits (Eurogentec, Belgium), and the resulting immune antisera were tested against the recombinant antigen by ELISA (Eurogentec) ...
-
bioRxiv - Developmental Biology 2022Quote: ... Purified protein was shipped for antibody production (custom polyclonal antibodies, Eurogentec). Rabbit polyclonal anti-Shp1 was purified in house by affinity purification ...
-
bioRxiv - Microbiology 2020Quote: ... Purified CexE protein was used to produce primary antibodies by Eurogentec using the 28-day speedy protocol ...
-
bioRxiv - Molecular Biology 2022Quote: ... After an overnight incubation at 4°C with the primary antibodies (anti-5mC, Eurogentec, ref BI-MECY-0100 ...
-
bioRxiv - Plant Biology 2019Quote: ... The purified recombinant protein was used to immunize rabbits by a company (Eurogentec). From the immunserum a crude IgG fraction was isolated by ammonium sulfate precipitation then IgG was further purified on protein gel blots of the antigen ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Molecular Biology 2023Quote: ... 0.3 mg of protein was used per rabbit for immunization of 2 rabbits (Eurogentec). Serum collected from one rabbit was affinity purified against GST-ATI11-180 ...
-
bioRxiv - Biochemistry 2023Quote: ... Membranes were then overnight incubated at 4°C with the anti-HA primary antibody (OptimAb HA. 11, Eurogentec), which was raised from mouse serum ...
-
bioRxiv - Microbiology 2022Quote: ... 0.8 mg protein was used for raising two antibodies against KhpB in rabbit (Eurogentec, speedy program).
-
bioRxiv - Microbiology 2023Quote: Antibodies against BacA were raised by immunization of rabbits with purified BacA-His6 protein (Eurogentec, Belgium). Cells were harvested in the exponential growth phase ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Biochemistry 2022Quote: Purified Fz4CRD-Connector and Fz7CRD proteins were incubated with a palmitoleoylated peptide (Wnt7a residues 202-209; Eurogentec)12 at a molar ratio of 1:1.25 overnight at 4°C in a buffer containing 10 mM HEPES ...
-
bioRxiv - Plant Biology 2024Quote: ... 4 µl of the diluted cDNA was used together with Takyon No Rox SYBR MasterMix dTTP Blue (Eurogentec, Seraing, Belgium). AT3G01150 was chosen as reference gene (Czechowski et al. ...
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Developmental Biology 2019Quote: ... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Cell Biology 2021Quote: ... We amplified 4 µL cDNA (50 ng) using 10 µL of Takyon™ No Rox SYBR MasterMix Blue dTTP (Eurogentec, Liege, Belgium), 2 µL of each reverse and forward primers (10 mM) ...
-
bioRxiv - Neuroscience 2020Quote: ... was induced in 8-week-old female SJL/J mice via subcutaneous immunization with 200 μg recombinant myelin proteolipid protein (PLP139-151, Eurogentec) in an emulsion mix (volume ratio 1:1 ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... The purified recombinant protein was then used as an antigen in an 87 days immunization program on Guinea pigs (outsourced to Eurogentec). The DMC1 antibody was then purified from antisera following affinity purification (using Affi-Gel 15 from Biorad ...
-
bioRxiv - Microbiology 2023Quote: ... the anti-KhpB was generated with a synthesized peptide derived from C- terminus of KhpB protein (H-CGRDPKRYIVIKKKRG-OH) in rabbits (Eurogentec). The KhpB anti- serum was tested with ELISA assay and further cleaned with affinity purification ...
-
bioRxiv - Microbiology 2023Quote: Polyclonal antisera against ComG pilins were produced by immunising rabbits with a mixture of two different peptides that were synthesised from each protein (Eurogentec). Peptides corresponding to the following residues in mature pilins were used ...
-
bioRxiv - Cell Biology 2023Quote: Recombinant full-size proteins were used to immunise different animals (Pineda, Berlin, Germany; Davids Biotechnology, Regensburg, Germany; Eurogentec, Seraing, Belgium). The resulting antisera were affinity purified against the immobilised recombinant protein ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Plant Biology 2021Quote: A solution containing 3.5 mg of purified recombinant LbGH28A protein was used to elicit the production of polyclonal antibodies in rabbit according to the manufacturer’s procedure (Eurogentec, Seraing, Belgium). The indirect immunofluorescent (IIF ...
-
bioRxiv - Microbiology 2022Quote: ... negevensis [62,63] and antibodies targeting NlpC of each bacterium (produced by immunization of mice with the purified proteins, Eurogentec, Seraing, Belgium). A subsequent incubation with secondary antibodies Alexa Fluor 488 goat anti-mouse and Alexa Fluor 594 donkey anti-rabbit (Thermo FisherScientific ...
-
bioRxiv - Microbiology 2019Quote: An MHC I class-restricted peptide from YFV-17D non-structural protein 3 (NS3) (sequence ATLTYRML) (57) was synthetized by Eurogentec (Seraing, Belgium). Total cellular antigen for YFV-17D and JEV SA14-14-2 was prepared first by infecting Vero E6 cells with 0.1 MOI YFV-17D or JEV SA14-14-2 ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mg of the peptide was coupled with the carrier protein KHL (Keyhole Limpet Hemocyanin) and was subsequently used to inoculate a rabbit (through the Eurogentec’s speedy program) for antibody production ...
-
bioRxiv - Microbiology 2022Quote: ... A region of 168 base pairs on the PB2 protein was amplified by RT-PCR using custom primers (Table S6)(Eurogentec, Maastricht, Netherlands) and the QIAGEN OneStep RT-PCR Kit (Qiagen ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Microbiology 2022Quote: ... 1 µl of these cultures were then placed onto 1 % (w/v) molecular biology-grade agarose (Eurogentec, Belgium) pads containing ddH2O (snap shots ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Microbiology 2023Quote: ... subtilis Rho (Eurogentec, Belgium; dilution 1:5,000) and the secondary peroxidase-coupled anti-rabbit IgG antibodies A0545 (Sigma-Aldrich ...
-
bioRxiv - Genomics 2023Quote: ... 1 μM Template-Switching Oligo (TSO, Eurogentec), 1 mM dNTP mix (Roche) ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Microbiology 2022Quote: ... The membrane was blocked with PBS + 5% milk for 1 hour at room temperature then incubated with a PBS + 1% milk solution containing a 1:2000 polyclonal anti-DnaA antibody (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...