Labshake search
Citations for Eurogentec :
51 - 100 of 174 citations for Anti Neurogenin 1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2020Quote: Custom-made antibodies (Eurogentec) against endogenous PIWI proteins were generated by immunization of two rabbits per antibody with a mix of two unique peptides (Ago3 ...
-
bioRxiv - Genomics 2024Quote: ... filiformis ParB antibody (Eurogentec) with a 1:1000 dilution ...
-
bioRxiv - Genomics 2024Quote: ... oneisti ParB antibody (Eurogentec). All primary antibodies were incubated in blocking solution overnight at 4°C ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-non-muscle myosin heavy chain II-A (NMIIA) (1:1000; PRB-440P-050, Eurogentec, Liege, Belgium), mouse anti-α-actinin (1:800 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Antibodies were purchased from Eurogentec. Plasmid extractions were performed using Qiagen miniprep kits ...
-
bioRxiv - Molecular Biology 2022Quote: ... Antibodies were purchased from Eurogentec. Plasmid extractions were performed using Qiagen miniprep kits ...
-
bioRxiv - Cancer Biology 2019Quote: ... KLK4/KLKP1 (Eurogentec custom synthesized antibody) and β-actin (Sigma ...
-
bioRxiv - Cell Biology 2020Quote: ... A subset of fibers from passive and active experiments were prepared with one or more of the primary antibodies specific for various parts of I-band titin: PEVK (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:500 in PBS), N2A (polyclonal IgG ...
-
bioRxiv - Neuroscience 2020Quote: Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin (Eurogentec, 1/50) and rabbit anti-neurofilament antibodies (Eurogentec ...
-
bioRxiv - Microbiology 2021Quote: ... Antibodies against TfcP were generated by Eurogentec against TfcPΔ1-18-His6 purified from E ...
-
bioRxiv - Cell Biology 2020Quote: ... All antibodies were custom made by Eurogentec.
-
bioRxiv - Molecular Biology 2021Quote: ... The OptimAb HA.11 monoclonal antibody (Eurogentec) was used to detect hemagglutinin (HA)-fusion proteins at the concentration of 0.5 μg/ml ...
-
bioRxiv - Neuroscience 2023Quote: ... an ASPM antibody was generated by Eurogentec by using a 16 amino acid peptide (ac-SVSQKVDRVRSPLQAC-con ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody was produced by Eurogentec (Seraing, Belgium).
-
bioRxiv - Molecular Biology 2020Quote: ... Antibody production in rabbit was done by Eurogentec (https://secure.eurogentec.com/eu-home.html) ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody’s affinity (Eurogentec; Peptide: 1911009, Rabbit 237) was confirmed through ELISA.
-
bioRxiv - Microbiology 2020Quote: ... Primary antibodies against Hcp (Eurogentec; Metzger et al., 2016) were used at 1:5,000 dilution while anti-Sigma70-HRP antibodies (BioLegend ...
-
bioRxiv - Genomics 2020Quote: ... A commercial monoclonal antibody against 5-methylcytidine from Eurogentec was used for immunoprecipitation ...
-
bioRxiv - Cell Biology 2021Quote: ... Polyclonal antibodies were raised against the fusion protein (Eurogentec). Immuno-reactive complexes were detected using horseradish-peroxidase coupled anti-rabbit or anti-mouse antibodies (Sigma-Aldrich/Merck ...
-
bioRxiv - Plant Biology 2019Quote: ... and used to raise polyclonal antibody in rabbits (Eurogentec). From the crude immunserum specific IgG fraction was isolated as described above.
-
bioRxiv - Molecular Biology 2019Quote: ... Pab-DnaG or Pab-aCPSF1 (custom polyclonal antibodies, Eurogentec) diluted 10,000-fold and an anti-rabbit IgG HRP conjugate (Promega ...
-
bioRxiv - Developmental Biology 2022Quote: ... Antibodies were raised in two guinea pigs by Eurogentec.
-
bioRxiv - Cell Biology 2023Quote: ... Custom rabbit pAb anti-pS62 and anti-pT61-pS62 NDC80 were raised by Eurogentec using a 28-day protocol ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-BBX22(199–213) (Eurogentec, raised in rabbits against the peptide C+DQSYEYMENNGSSKT and affinity purified) ...
-
bioRxiv - Cell Biology 2020Quote: ... or pHH3 ser10 (custom antibody to peptide ARTKQTARKS*TGGKAPRKQLASK: Eurogentec) overnight at 4°C ...
-
bioRxiv - Microbiology 2021Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody using an ImageQuant LAS 4000 mini digital imaging system (GE Healthcare) ...
-
bioRxiv - Cancer Biology 2022Quote: ... HPV-16 E7 pS31/S32 peptide antibody generated by Eurogentec has been described previously [12] ...
-
bioRxiv - Biochemistry 2021Quote: ... The antibody was affinity purified against the antigen by Eurogentec, and used at a 1:50 dilution ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti- rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Proteins were probed via α-DnaD polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Developmental Biology 2019Quote: ... The antibody was produced in guinea pigs by Eurogentec (Liège, Belgium).
-
bioRxiv - Neuroscience 2020Quote: ... Polyclonal antibodies targeting Ush2A were generated in the rabbit by Eurogentec® (Liege ...
-
bioRxiv - Microbiology 2021Quote: ... Gel portions containing CcrZ was sent for antibody production by Eurogentec.
-
bioRxiv - Microbiology 2020Quote: ... Purified CexE protein was used to produce primary antibodies by Eurogentec using the 28-day speedy protocol ...
-
bioRxiv - Cell Biology 2023Quote: A custom polyclonal antibody to RAB18 generated by Eurogentec (Southampton, UK) has been described previously (10) ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Antibodies against the H2A.W.6 phosphopeptide (CEEKATKSPVKSpPKKA) were raised in rabbits (Eurogentec) and purified by peptide affinity column ...
-
bioRxiv - Microbiology 2020Quote: ... and those with Hcp pooled and used to generate polyclonal antibodies (EuroGentec).
-
bioRxiv - Cell Biology 2023Quote: ... A third polyclonal antibody (508) was generated against two TbSmee1 peptides (Eurogentec) and affinity purified using the peptide antigens immobilised on a Sulfolink affinity column (ThermoFisher) ...
-
bioRxiv - Neuroscience 2019Quote: The custom-made CNK2 antibody used in this study was produced by Eurogentec. It was raised in guinea pig against a KHL-conjugated peptide representing CNK2 amino-acids 727-741 and affinity matrix purified ...
-
bioRxiv - Molecular Biology 2019Quote: ... a polyclonal exWAGO antibody was used (generated and purified against peptides TKQTKDDFPEQERK, Eurogentec) overnight at 4°C ...
-
bioRxiv - Microbiology 2019Quote: ... All polyclonal antibodies were purified from pooled sera of two immunized rabbits (Eurogentec).
-
bioRxiv - Developmental Biology 2024Quote: Polyclonal antibodies against Spar (CG4577) were custom generated in guinea pigs by Eurogentec. Two Spar peptides corresponding to epitopes LQEIDDYVPERRVSS (amino acids 212-226 ...
-
bioRxiv - Cell Biology 2021Quote: ... 2Y4824 rabbit anti-pre-immune serum (PIS; Eurogentec) was used for control purposes ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Plant Biology 2020Quote: ... WOX9 peptide antibodies used for ChIP assays were synthesized by Eurogentec (https://www.eurogentec.com/en/) using amino acid sequences specific for SRB homolog Phvul.006G179900 and SB homolog Glyma.11G210800 (Fig ...
-
bioRxiv - Neuroscience 2023Quote: Zebrafish peptide specific antibodies were generated in an 87-day classical program by Eurogentec S.A ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...