Labshake search
Citations for Eurogentec :
1 - 50 of 106 citations for 7 nitro 3 phenyl 1 naphthyl 4 nitrophenylacetate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: Double-stranded siRNA oligonucleotides used were 5’- CAGUACCAGUGAGUGGCCCCACCUG-3’ (NuMA 3’UTR siRNA; Eurogentec) and 5’-CACCGUGUGUCUAAGCAAA-3’ (RCC1 siRNA ...
-
bioRxiv - Developmental Biology 2022Quote: ... engMutfwd 5’-AGAACAGACGAATCTACAGCCGAA-3’ and engintron2rev 5’-AGCATGTTTTAACAAGACGGCAG-3’ primers and HotGoldStar PCR mix (Eurogentec).
-
bioRxiv - Microbiology 2020Quote: ... Extracted DNA was incorporated into real-time PCR performed using Metha_16S_2_MBF: 5’-CGAACCGGATTAGATACCCG -3’ and Metha_16S_2_MBR: 5’-CCCGCCAATTCCTTTAAGTT-3’ primers (Eurogentec, Angers, France) and FAM_Metha_16S_2_MBP 6FAM-CCTGGGAAGTACGGTCGCAAG probe targeting the 16S DNA gene of methanogens ...
-
bioRxiv - Immunology 2023Quote: ... Cxcl3 reverse: 5’-CCTTGGGGGTTGAGGCAAACTT-3’ (Eurogentec) for the quantification of Cxcl1 ...
-
bioRxiv - Neuroscience 2023Quote: ... Capture antibodies were: our previously described custom rabbit anti-(GR)7 antibody (Eurogentec 2 µg/mL) 90 ...
-
bioRxiv - Cancer Biology 2023Quote: ... 8-week-old tamoxified ElaK mice received 7 hourly intraperitoneal injections of cerulein (AS-24252, Eurogentec. 100-150 μl in phosphate buffered saline-PBS ...
-
bioRxiv - Biophysics 2020Quote: ... Oligonucleotides (c-Myc and ds26; sequences = 5’-TGAGGGTGGGTAGGGTGGGTAA-3’ and 5’-CAATCGGATCGAATTCGATCCGATTG-3’, respectively) were purchased from Eurogentec, and dissolved in 10 mM lithium cacodylate buffer at pH 7.3 ...
-
bioRxiv - Cell Biology 2019Quote: ... For IFT88 knockdown: 5’-GCUGUGAACUCGGAUAGAU-3’ (Eurogentec) or siGENOME Mouse Ift88 (21821 ...
-
bioRxiv - Cell Biology 2020Quote: ... and 5’-CACCGUGUGUCUAAGCAAA-3’ (RCC1 siRNA; Eurogentec).
-
bioRxiv - Cell Biology 2021Quote: ... 5’- ACUGACGACUCUGCUACUC-3’ (Luc; Eurogentec, Seraing, Belgium) or ON-TARGETplus Non-targeting siRNA #1 (Cont ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... reverse primer (5’-GAGACCCTCCGAAAATAGGC −3’) (Eurogentec, Belgium) (1μl)(10μm) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... forward primer (5’-AATTCGGGGAGCGATCCTG −3’) (Eurogentec, Belgium) (1μl)(10μm) ...
-
bioRxiv - Cancer Biology 2020Quote: ... The expression of VEGF (F: 5’-GACTCCGGCGGAAGCAT-3’ R: 5’-TCCGGGCTCGGTGATTTA-3’) was detected with SYBR Green I (Eurogentec). Gene expression was normalised to RPL13A (F ...
-
bioRxiv - Microbiology 2019Quote: ... Oligonucleotides (Table 3) were synthesized by Eurogentec (Belgium). PCRs were performed in Applied Biosystems 2720 Thermak thermocycler (ABI) ...
-
bioRxiv - Molecular Biology 2019Quote: ... at an annealing temperature of 60°C (forward primer 5’-TCGAACCCTTGCCACTCATC-3’ and reverse primer 5’-GCACAAACGGCCAGGAAATC-3’, synthesised by Eurogentec, Southampton, UK).
-
bioRxiv - Cell Biology 2019Quote: ... elegans PTC-3 were generated in rabbits by Eurogentec using peptides SASHSSDDESSPAHK and EVRRGPELPKENGLG ...
-
bioRxiv - Physiology 2023Quote: ... Fluorescein-Trp25-Exendin-4 (FLEX; Eurogentec; 0.5μg/μL), Exendin-9 (Ex9 ...
-
bioRxiv - Molecular Biology 2022Quote: ... membranes were blocked in 5% milk PBS-T (1X PBS buffer with 0.1% Tween-20) and incubated overnight at 4°C with one of the following antibodies: anti-HA.11 (1:2,000; Eurogentec, Cat# MMS-101P-500), anti-Stm1 (1:10,000 ...
-
bioRxiv - Cell Biology 2023Quote: ... hGBF1 (5’- CCUCUGUCAACAAGUUCCU-3’) and control siRNA was purchased from Eurogentec. Following plasmids used in this study were described previously ...
-
bioRxiv - Developmental Biology 2021Quote: ... cDNAs were amplified by Q-PCR using 5’ and 3’ oligonucleotides (Eurogentec) specific to each gene ...
-
bioRxiv - Molecular Biology 2020Quote: ... in cuvettes with a 4-mm inter-electrode distance (Eurogentec). Transfected cells were grown for 48 h in the presence of 7 µM ouabain (Sigma ...
-
bioRxiv - Cancer Biology 2023Quote: ... Primers were purchased from Qiagen (miScript Primer Assay range) and from Eurogentec (primer list Supp. Table 4) to respectively amplify miRNA and mRNA ...
-
bioRxiv - Microbiology 2021Quote: ... Primer 3 program available online was used for primer design and primers were synthesized by Eurogentec. The primer efficiency was evaluated and primer pairs showing an efficiency between 90 and 110% in the qPCR analysis were selected ...
-
bioRxiv - Molecular Biology 2022Quote: ... After an overnight incubation at 4°C with the primary antibodies (anti-5mC, Eurogentec, ref BI-MECY-0100 ...
-
bioRxiv - Microbiology 2019Quote: ... The tissue sections were incubated with the universal bacterial probe EUB338 (5’-GCTGCCTCCCGTAGGAGT-3’) (Eurogentec, Liège, Belgium) conjugated to Alexa Fluor 594 ...
-
bioRxiv - Microbiology 2020Quote: ... or 500 ng to 3 µg for integrative plasmids (MicroPulserTM electroporator Biorad in 2 mm cuvettes (Eurogentec) at 25 µF ...
-
bioRxiv - Microbiology 2023Quote: ... For HuR knockdown experiment we transfected 150nM of either DsiHuR: 5’AUUUCUGAAUCUGUGACGCAAGAAT 3’(IDT) or Nonspecific (Eurogentec) siRNA 24 hrs prior to luciferase construct transfection.
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Developmental Biology 2020Quote: ... Non-targeting control siRNA and siRNA duplexes targeting Sorbs1 (5’-UUAAGUCCUGAGUGCUCUUC-3’) were synthesized and purchased from Eurogentec.
-
bioRxiv - Cell Biology 2023Quote: ... CD79α and glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was measured by RT-qPCR using Takyon SYBR Master Mix (Eurogentec), 100nM of specific primers ...
-
bioRxiv - Cell Biology 2021Quote: ... 2015b) directly labeled with a fluorophore in 3’ end (sequences are detailed in Table S1) were purchased from Eurogentec. These probes located (Fig ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti-uL11K3me3 antibodies were generated in rabbit using a peptide corresponding to the first 16 amino acids of uL11 with methylated lysine 3 [PPK(me3)FDPTEVKLVYLRC] (Eurogentec). The serum was first loaded on a uL11K3me3 peptide affinity column which allowed to retain anti-uL11K3me3 and anti-uL11 antibodies ...
-
bioRxiv - Immunology 2021Quote: Immunising and screening peptides are outlined in S.Table 2 (Figure 3-figure supplement 2) and were synthesized by Eurogentec (Belgium). A portion was further conjugated to Key Lymphocyte Haemoglutinin (KLH ...
-
bioRxiv - Biochemistry 2023Quote: ... Membranes were then overnight incubated at 4°C with the anti-HA primary antibody (OptimAb HA. 11, Eurogentec), which was raised from mouse serum ...
-
bioRxiv - Neuroscience 2021Quote: ... aiming to skip DMD exon 51 (51-[T*C*A*A*G*G*A*A*G*A*T*G*G*C*A*T*T*T*C*T]-3⍰, Eurogentec, Belgium) by transfection with Lipofectamine as described in43,44 and analysed by either myoblot (96 well plates ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinitiesbioRxiv - Biochemistry 2019Quote: ... HA tagged proteins were labeled overnight at 4°C with the mouse HA.11 Clone 16B12 Monoclonal Antibody (Eurogentec) 1/2000 in PBS + tween 0.2% (v/v ...
-
bioRxiv - Microbiology 2019Quote: An MHC I class-restricted peptide from YFV-17D non-structural protein 3 (NS3) (sequence ATLTYRML) (57) was synthetized by Eurogentec (Seraing, Belgium). Total cellular antigen for YFV-17D and JEV SA14-14-2 was prepared first by infecting Vero E6 cells with 0.1 MOI YFV-17D or JEV SA14-14-2 ...
-
bioRxiv - Plant Biology 2024Quote: ... 4 µl of the diluted cDNA was used together with Takyon No Rox SYBR MasterMix dTTP Blue (Eurogentec, Seraing, Belgium). AT3G01150 was chosen as reference gene (Czechowski et al. ...
-
bioRxiv - Microbiology 2023Quote: ... a 20 µl mixture containing 3 µl of RNA was prepared using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Cell Biology 2021Quote: ... We amplified 4 µL cDNA (50 ng) using 10 µL of Takyon™ No Rox SYBR MasterMix Blue dTTP (Eurogentec, Liege, Belgium), 2 µL of each reverse and forward primers (10 mM) ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Microbiology 2022Quote: ... 1 µl of these cultures were then placed onto 1 % (w/v) molecular biology-grade agarose (Eurogentec, Belgium) pads containing ddH2O (snap shots ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...