Labshake search
Citations for Eurogentec :
1 - 50 of 110 citations for 6 Phenyl piperidine 1 3 dicarboxylic acid 1 tert butyl ester since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti-uL11K3me3 antibodies were generated in rabbit using a peptide corresponding to the first 16 amino acids of uL11 with methylated lysine 3 [PPK(me3)FDPTEVKLVYLRC] (Eurogentec). The serum was first loaded on a uL11K3me3 peptide affinity column which allowed to retain anti-uL11K3me3 and anti-uL11 antibodies ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Cell Biology 2020Quote: Double-stranded siRNA oligonucleotides used were 5’- CAGUACCAGUGAGUGGCCCCACCUG-3’ (NuMA 3’UTR siRNA; Eurogentec) and 5’-CACCGUGUGUCUAAGCAAA-3’ (RCC1 siRNA ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Developmental Biology 2022Quote: ... engMutfwd 5’-AGAACAGACGAATCTACAGCCGAA-3’ and engintron2rev 5’-AGCATGTTTTAACAAGACGGCAG-3’ primers and HotGoldStar PCR mix (Eurogentec).
-
bioRxiv - Microbiology 2020Quote: ... Extracted DNA was incorporated into real-time PCR performed using Metha_16S_2_MBF: 5’-CGAACCGGATTAGATACCCG -3’ and Metha_16S_2_MBR: 5’-CCCGCCAATTCCTTTAAGTT-3’ primers (Eurogentec, Angers, France) and FAM_Metha_16S_2_MBP 6FAM-CCTGGGAAGTACGGTCGCAAG probe targeting the 16S DNA gene of methanogens ...
-
bioRxiv - Microbiology 2022Quote: ... 1 µl of these cultures were then placed onto 1 % (w/v) molecular biology-grade agarose (Eurogentec, Belgium) pads containing ddH2O (snap shots ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Microbiology 2023Quote: ... subtilis Rho (Eurogentec, Belgium; dilution 1:5,000) and the secondary peroxidase-coupled anti-rabbit IgG antibodies A0545 (Sigma-Aldrich ...
-
bioRxiv - Genomics 2023Quote: ... 1 μM Template-Switching Oligo (TSO, Eurogentec), 1 mM dNTP mix (Roche) ...
-
bioRxiv - Immunology 2023Quote: ... Cxcl3 reverse: 5’-CCTTGGGGGTTGAGGCAAACTT-3’ (Eurogentec) for the quantification of Cxcl1 ...
-
An Azobenzene G-quadruplex Ligand Exhibits Promising Antibacterial Activity against Escherichia colibioRxiv - Microbiology 2022Quote: All oligonucleotides used (Table 6) were purchased from Eurogentec (Belgium), purified by HPLC and delivered dry ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Microbiology 2022Quote: ... The membrane was blocked with PBS + 5% milk for 1 hour at room temperature then incubated with a PBS + 1% milk solution containing a 1:2000 polyclonal anti-DnaA antibody (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...
-
bioRxiv - Biophysics 2020Quote: ... Oligonucleotides (c-Myc and ds26; sequences = 5’-TGAGGGTGGGTAGGGTGGGTAA-3’ and 5’-CAATCGGATCGAATTCGATCCGATTG-3’, respectively) were purchased from Eurogentec, and dissolved in 10 mM lithium cacodylate buffer at pH 7.3 ...
-
bioRxiv - Neuroscience 2020Quote: ... and rabbit anti-neurofilament antibodies (Eurogentec, 1/50) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Microbiology 2020Quote: ... Real-time qPCR was conducted on a Stepone plus real-time PCR system from Applied Biosystems using specific primers (Table 1) (Eurogentec, Seraing, Belgium), SYBR green reagents and ROX reference dye (Thermo Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Cell Biology 2019Quote: ... For IFT88 knockdown: 5’-GCUGUGAACUCGGAUAGAU-3’ (Eurogentec) or siGENOME Mouse Ift88 (21821 ...
-
bioRxiv - Cell Biology 2020Quote: ... and 5’-CACCGUGUGUCUAAGCAAA-3’ (RCC1 siRNA; Eurogentec).
-
bioRxiv - Cell Biology 2021Quote: ... 5’- ACUGACGACUCUGCUACUC-3’ (Luc; Eurogentec, Seraing, Belgium) or ON-TARGETplus Non-targeting siRNA #1 (Cont ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... reverse primer (5’-GAGACCCTCCGAAAATAGGC −3’) (Eurogentec, Belgium) (1μl)(10μm) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... forward primer (5’-AATTCGGGGAGCGATCCTG −3’) (Eurogentec, Belgium) (1μl)(10μm) ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Microbiology 2020Quote: A 16 amino acids peptide (nh2-CMHRDYNHDMSDKHRA −conh2) was designed by Eurogentec based on the provide sequence of AOX of Naegleria gruberi (XP_002672918 ...
-
bioRxiv - Cancer Biology 2020Quote: ... The expression of VEGF (F: 5’-GACTCCGGCGGAAGCAT-3’ R: 5’-TCCGGGCTCGGTGATTTA-3’) was detected with SYBR Green I (Eurogentec). Gene expression was normalised to RPL13A (F ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...
-
bioRxiv - Cancer Biology 2022Quote: ... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
bioRxiv - Plant Biology 2022Quote: ... and α-BAK1 (1/5,000; custom-made by Eurogentec). For the uncropped blots see Figure S3.
-
bioRxiv - Cell Biology 2021Quote: cy3-BHQ2 pre-miR-181a-1 molecular beacon (Eurogentec): 5’-CAUUGCCUUUAGAUACCAAUG -3’ ...
-
bioRxiv - Microbiology 2022Quote: ... A 1-kb DNA ladder (Smartladder, Eurogentec, Seraing, Belgium) was added as a reference marker ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-FPN antibody (1:2,000, Eurogentec, NRU 451443), rabbit anti-FTH (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... 0,25 µM end concentration probe (Supplementary table 1, Eurogentec) and nuclease free water ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Antibodies against the H2A.W.6 phosphopeptide (CEEKATKSPVKSpPKKA) were raised in rabbits (Eurogentec) and purified by peptide affinity column ...
-
bioRxiv - Microbiology 2019Quote: ... Oligonucleotides (Table 3) were synthesized by Eurogentec (Belgium). PCRs were performed in Applied Biosystems 2720 Thermak thermocycler (ABI) ...
-
bioRxiv - Microbiology 2020Quote: ... 6 M urea and used to immunize rabbits (Eurogentec, 28-day speedy protocol). The α-CglB 1° pAb produced was then tested for specificity by using the wild-type and the ΩcglB strains ...
-
bioRxiv - Biophysics 2019Quote: ... and Oregon Green 488 maleimide were purchased from LIFE TECHNOLOGIES LTD (Paisley, UK) and 6-bromoacetyl-2-dimethylaminonaphthalene (BADAN) from EUROGENTEC (Southampton, UK). N-(2-(iodoacetamido)ethyl)-7-diethylaminocoumarin-3-carboxamide (IDCC ...
-
bioRxiv - Molecular Biology 2019Quote: ... at an annealing temperature of 60°C (forward primer 5’-TCGAACCCTTGCCACTCATC-3’ and reverse primer 5’-GCACAAACGGCCAGGAAATC-3’, synthesised by Eurogentec, Southampton, UK).
-
bioRxiv - Cell Biology 2019Quote: ... elegans PTC-3 were generated in rabbits by Eurogentec using peptides SASHSSDDESSPAHK and EVRRGPELPKENGLG ...
-
bioRxiv - Plant Biology 2023Quote: ... The ad-hoc designed peptide nucleotide acid (PNA) blocker oligos (Kaneka Eurogentec S.A., Belgium) for V ...
-
bioRxiv - Microbiology 2023Quote: Forward primers were marked in 5’ with 6-FAM or HEX fluorophores (Eurogentec®) and when useful ...