Labshake search
Citations for Eurogentec :
51 - 100 of 125 citations for 6 Methyl benzo 1 3 dioxole 5 carbaldehyde since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Cell Biology 2023Quote: ... CD79α and glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was measured by RT-qPCR using Takyon SYBR Master Mix (Eurogentec), 100nM of specific primers ...
-
bioRxiv - Cell Biology 2021Quote: ... 2015b) directly labeled with a fluorophore in 3’ end (sequences are detailed in Table S1) were purchased from Eurogentec. These probes located (Fig ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti-uL11K3me3 antibodies were generated in rabbit using a peptide corresponding to the first 16 amino acids of uL11 with methylated lysine 3 [PPK(me3)FDPTEVKLVYLRC] (Eurogentec). The serum was first loaded on a uL11K3me3 peptide affinity column which allowed to retain anti-uL11K3me3 and anti-uL11 antibodies ...
-
bioRxiv - Immunology 2021Quote: Immunising and screening peptides are outlined in S.Table 2 (Figure 3-figure supplement 2) and were synthesized by Eurogentec (Belgium). A portion was further conjugated to Key Lymphocyte Haemoglutinin (KLH ...
-
bioRxiv - Neuroscience 2021Quote: ... aiming to skip DMD exon 51 (51-[T*C*A*A*G*G*A*A*G*A*T*G*G*C*A*T*T*T*C*T]-3⍰, Eurogentec, Belgium) by transfection with Lipofectamine as described in43,44 and analysed by either myoblot (96 well plates ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Microbiology 2019Quote: An MHC I class-restricted peptide from YFV-17D non-structural protein 3 (NS3) (sequence ATLTYRML) (57) was synthetized by Eurogentec (Seraing, Belgium). Total cellular antigen for YFV-17D and JEV SA14-14-2 was prepared first by infecting Vero E6 cells with 0.1 MOI YFV-17D or JEV SA14-14-2 ...
-
bioRxiv - Plant Biology 2021Quote: ... in 10 µl mixtures each containing 5 µl of Takyon™ ROX SYBR® MasterMix dTTP Blue (Eurogentec, UF-RSMT-B0710 ...
-
bioRxiv - Microbiology 2023Quote: ... a 20 µl mixture containing 3 µl of RNA was prepared using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Physiology 2019Quote: ... technical triplicates were performed on 5 ng of cDNA using Takyon Low ROX SYBR 2X MasterMix blue dTTP (Eurogentec) on a ViiA™7 thermal cycler (Applied Biosystems) ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Biochemistry 2021Quote: ... 21T (5’ TTA-GGG-TTA-GGG-TTA-GGG-TTA-GGG-TT-TEG-biot) and scramble (5’ AAG-TGT-GTG-TGT-GTG-TGT-GTG-TGA-AG-TEG-biot) sequences were purchased from Eurogentec.
-
bioRxiv - Microbiology 2021Quote: ... one-step qPCR assay was performed using 5 μL of RNA and Takyon Low rox one-step RT probe Mastermix (Eurogentec) and specific primers and probe targeting E gene ...
-
bioRxiv - Molecular Biology 2024Quote: ... The 30-bp complementary DNA fragments corresponding to the marRAB or acrAB marboxes with 5 nucleotides in each flank were purchased from Eurogentec (Seraing ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Plant Biology 2024Quote: ... PCR was performed on a Applied Biosystems™ QuantStudio™ 5 Real-Time PCR System with SYBR Green PCR MasterMix (Eurogentec). Each reaction was performed on a 1:20 dilution of the cDNA ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Bioengineering 2022Quote: ... 3.75 μL of the appropriately diluted samples (ranging from 4 to 12.5-fold) were mixed with 7.5 μL of qPCR mastermix (MasterMix Plus for SYBR© Green I with fluorescein, Eurogentec, Liège, Belgium) in a final volume of 15 μL ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Microbiology 2022Quote: ... 1 µl of these cultures were then placed onto 1 % (w/v) molecular biology-grade agarose (Eurogentec, Belgium) pads containing ddH2O (snap shots ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Microbiology 2023Quote: ... subtilis Rho (Eurogentec, Belgium; dilution 1:5,000) and the secondary peroxidase-coupled anti-rabbit IgG antibodies A0545 (Sigma-Aldrich ...
-
bioRxiv - Genomics 2023Quote: ... 1 μM Template-Switching Oligo (TSO, Eurogentec), 1 mM dNTP mix (Roche) ...
-
bioRxiv - Genomics 2021Quote: ... in a final volume of 10 µL (0.5 µL of each primer, 5 µL of Eurogentec Takyon™ SYBR® 2 x qPCR Mastermix Blue). The following Light-Cycler run protocol was used ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Microbiology 2022Quote: ... The membrane was blocked with PBS + 5% milk for 1 hour at room temperature then incubated with a PBS + 1% milk solution containing a 1:2000 polyclonal anti-DnaA antibody (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...
-
bioRxiv - Neuroscience 2020Quote: ... and rabbit anti-neurofilament antibodies (Eurogentec, 1/50) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Microbiology 2020Quote: ... Real-time qPCR was conducted on a Stepone plus real-time PCR system from Applied Biosystems using specific primers (Table 1) (Eurogentec, Seraing, Belgium), SYBR green reagents and ROX reference dye (Thermo Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...
-
bioRxiv - Cancer Biology 2022Quote: ... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
bioRxiv - Plant Biology 2022Quote: ... and α-BAK1 (1/5,000; custom-made by Eurogentec). For the uncropped blots see Figure S3.
-
bioRxiv - Cell Biology 2021Quote: cy3-BHQ2 pre-miR-181a-1 molecular beacon (Eurogentec): 5’-CAUUGCCUUUAGAUACCAAUG -3’ ...
-
bioRxiv - Microbiology 2022Quote: ... A 1-kb DNA ladder (Smartladder, Eurogentec, Seraing, Belgium) was added as a reference marker ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-FPN antibody (1:2,000, Eurogentec, NRU 451443), rabbit anti-FTH (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... 0,25 µM end concentration probe (Supplementary table 1, Eurogentec) and nuclease free water ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Cell Biology 2021Quote: NCAPH2: Rabbit polyclonal produced on demand by Eurogentec (WB:1/1000).
-
bioRxiv - Microbiology 2020Quote: DNA oligonucleotides (Table 1) for CD analysis were obtained from Eurogentec (Belgium), supplied at 1000 nmol scale ...
-
bioRxiv - Cell Biology 2019Quote: Oligonucleotides encoding P2A and homologous sequences were purchased from Eurogentec (table 1). P2A was substituted for T2A using the PCR Geiser method [22] ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... supernatants (1 μg/mL of lysate) were treated with DNAse I (Eurogentec) for 1 hour on ice ...
-
bioRxiv - Neuroscience 2019Quote: ... Primers (detailed in Supplementary data, Supplementary Table 1) were purchased from Eurogentec (France).
-
bioRxiv - Microbiology 2019Quote: ... 1.25 μL of 10 μM primers (reported in Table 1) (Eurogentec, Seraing, Belgium) and 1.25 μL of water ...