Labshake search
Citations for Eurogentec :
1 - 50 of 79 citations for 6 Isopropyl 7 methoxy 1 tetralone since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
An Azobenzene G-quadruplex Ligand Exhibits Promising Antibacterial Activity against Escherichia colibioRxiv - Microbiology 2022Quote: All oligonucleotides used (Table 6) were purchased from Eurogentec (Belgium), purified by HPLC and delivered dry ...
-
bioRxiv - Neuroscience 2023Quote: ... Capture antibodies were: our previously described custom rabbit anti-(GR)7 antibody (Eurogentec 2 µg/mL) 90 ...
-
bioRxiv - Cancer Biology 2023Quote: ... 8-week-old tamoxified ElaK mice received 7 hourly intraperitoneal injections of cerulein (AS-24252, Eurogentec. 100-150 μl in phosphate buffered saline-PBS ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Antibodies against the H2A.W.6 phosphopeptide (CEEKATKSPVKSpPKKA) were raised in rabbits (Eurogentec) and purified by peptide affinity column ...
-
bioRxiv - Microbiology 2020Quote: ... 6 M urea and used to immunize rabbits (Eurogentec, 28-day speedy protocol). The α-CglB 1° pAb produced was then tested for specificity by using the wild-type and the ΩcglB strains ...
-
bioRxiv - Biophysics 2019Quote: ... and Oregon Green 488 maleimide were purchased from LIFE TECHNOLOGIES LTD (Paisley, UK) and 6-bromoacetyl-2-dimethylaminonaphthalene (BADAN) from EUROGENTEC (Southampton, UK). N-(2-(iodoacetamido)ethyl)-7-diethylaminocoumarin-3-carboxamide (IDCC ...
-
bioRxiv - Microbiology 2023Quote: Forward primers were marked in 5’ with 6-FAM or HEX fluorophores (Eurogentec®) and when useful ...
-
bioRxiv - Genetics 2023Quote: ... Target sequences (primer list in Additional file 6) were amplified with MESA BLUE qPCR MasterMix Plus (Eurogentec) or KAPA SYBR FAST Roche LightCycler 480 qPCR Master Mix (Kapa Biosystems ...
-
bioRxiv - Molecular Biology 2021Quote: ... the cells were incubated in Opti-MEM for 5–6 h with Ambion pre-designed Silencer-Select siRNA or custom-designed siRNA from Eurogentec or scrambled siRNA (control siRNA ...
-
bioRxiv - Microbiology 2020Quote: Quantitative PCR was performed in a total reaction volume of 12.5 μl containing 6 μl Takyon™ Low Rox SYBR® MasterMix dTTP Blue (Eurogentec), 0.5 μl of each primer (5μM) ...
-
bioRxiv - Genetics 2021Quote: ... virus-specific primers (HHV-6B POL F and HHV-6B POL R) and FAM-labelled HHV-6B POL (U38) probe (Eurogentec; Supplementary Table 6) at 300 nM and 200 nM respectively ...
-
bioRxiv - Developmental Biology 2021Quote: ... 0.1 mM mixed primers (Ef2/Er3/L3f/Lxr, 1:1:1:1, Eurogentec, France), 1x Q solution and 0.017 units of HotStar Taq Plus DNA polymerase (Qiagen ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Microbiology 2022Quote: ... 1 µl of these cultures were then placed onto 1 % (w/v) molecular biology-grade agarose (Eurogentec, Belgium) pads containing ddH2O (snap shots ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Microbiology 2023Quote: ... subtilis Rho (Eurogentec, Belgium; dilution 1:5,000) and the secondary peroxidase-coupled anti-rabbit IgG antibodies A0545 (Sigma-Aldrich ...
-
bioRxiv - Genomics 2023Quote: ... 1 μM Template-Switching Oligo (TSO, Eurogentec), 1 mM dNTP mix (Roche) ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Microbiology 2022Quote: ... The membrane was blocked with PBS + 5% milk for 1 hour at room temperature then incubated with a PBS + 1% milk solution containing a 1:2000 polyclonal anti-DnaA antibody (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...
-
bioRxiv - Neuroscience 2020Quote: ... and rabbit anti-neurofilament antibodies (Eurogentec, 1/50) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Microbiology 2020Quote: ... Real-time qPCR was conducted on a Stepone plus real-time PCR system from Applied Biosystems using specific primers (Table 1) (Eurogentec, Seraing, Belgium), SYBR green reagents and ROX reference dye (Thermo Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...
-
bioRxiv - Cancer Biology 2022Quote: ... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
bioRxiv - Plant Biology 2022Quote: ... and α-BAK1 (1/5,000; custom-made by Eurogentec). For the uncropped blots see Figure S3.
-
bioRxiv - Cell Biology 2021Quote: cy3-BHQ2 pre-miR-181a-1 molecular beacon (Eurogentec): 5’-CAUUGCCUUUAGAUACCAAUG -3’ ...
-
bioRxiv - Microbiology 2022Quote: ... A 1-kb DNA ladder (Smartladder, Eurogentec, Seraing, Belgium) was added as a reference marker ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-FPN antibody (1:2,000, Eurogentec, NRU 451443), rabbit anti-FTH (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... 0,25 µM end concentration probe (Supplementary table 1, Eurogentec) and nuclease free water ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Cell Biology 2021Quote: NCAPH2: Rabbit polyclonal produced on demand by Eurogentec (WB:1/1000).
-
bioRxiv - Microbiology 2020Quote: DNA oligonucleotides (Table 1) for CD analysis were obtained from Eurogentec (Belgium), supplied at 1000 nmol scale ...
-
bioRxiv - Cell Biology 2019Quote: Oligonucleotides encoding P2A and homologous sequences were purchased from Eurogentec (table 1). P2A was substituted for T2A using the PCR Geiser method [22] ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... supernatants (1 μg/mL of lysate) were treated with DNAse I (Eurogentec) for 1 hour on ice ...
-
bioRxiv - Neuroscience 2019Quote: ... Primers (detailed in Supplementary data, Supplementary Table 1) were purchased from Eurogentec (France).
-
bioRxiv - Microbiology 2019Quote: ... 1.25 μL of 10 μM primers (reported in Table 1) (Eurogentec, Seraing, Belgium) and 1.25 μL of water ...
-
bioRxiv - Immunology 2020Quote: ... qPCR assays were performed using primers purchased from Eurogentec (Seraing, Belgium; Table 1) and specific for the gene coding for the flaA and flaB subunit genes ...
-
bioRxiv - Synthetic Biology 2022Quote: ... with Highlighter plasmids in 1 mm electroporation cuvettes (Eurogentec, Cat#CE-0001-50) using an Eppendorf Multiporator (Cat#4308 ...
-
bioRxiv - Biophysics 2023Quote: ... cavin-1/PTRF (L-012807-02-0005) or control RNAi SR-CL000 (Eurogentec) was used at 100 nM via magnetofection technology (OZ Biosciences ...
-
Cultivation and characterization of human midbrain organoids in sensor integrated microfluidic chipsbioRxiv - Bioengineering 2019Quote: ... The following first antibodies were used: anti-rabbit Tuj1 (Optim AB Eurogentec, 1:600); anti-rabbit TH (SantaCruz ...