Labshake search
Citations for Eurogentec :
151 - 173 of 173 citations for Rabbit Anti West Nile Virus Envelope Protein Antibody 9E2 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: Zebrafish peptide specific antibodies were generated in an 87-day classical program by Eurogentec S.A ...
-
bioRxiv - Plant Biology 2019Quote: ... Anti-5-methylcytosine (Eurogentec BI-MECY-0100, lot: vt150601) or anti-H3K9me2 (Abcam ab1220 ...
-
bioRxiv - Microbiology 2019Quote: An MHC I class-restricted peptide from YFV-17D non-structural protein 3 (NS3) (sequence ATLTYRML) (57) was synthetized by Eurogentec (Seraing, Belgium). Total cellular antigen for YFV-17D and JEV SA14-14-2 was prepared first by infecting Vero E6 cells with 0.1 MOI YFV-17D or JEV SA14-14-2 ...
-
bioRxiv - Microbiology 2022Quote: ... A region of 168 base pairs on the PB2 protein was amplified by RT-PCR using custom primers (Table S6)(Eurogentec, Maastricht, Netherlands) and the QIAGEN OneStep RT-PCR Kit (Qiagen ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Cell Biology 2020Quote: ... The anti-M6 antiserum was generated by immunizing guinea pigs (Eurogentec) with the peptides RRNSYRSDHSLDRYT and NLNELEYSATSKDRF (corresponding to aa 102-116 and 354-368 in M6 isoform F ...
-
bioRxiv - Plant Biology 2019Quote: ... NAR2.1 was detected using one anti-NAR2.1 antisera produced by Eurogentec against the synthetic peptide DVTTKPSREGPGVVL (anti-NAR2.1) ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... A guinea pig antibody was then raised against the purified peptide by Eurogentec (Kaneka Eurogentec S.A., Belgium). Finally ...
-
bioRxiv - Plant Biology 2019Quote: ... NRT2.1 was detected using three different anti-NRT2.1 antisera produced by Eurogentec against either the synthetic peptide TLEKAGEVAKDKFGK (anti-NRT2.1 19) ...
-
bioRxiv - Cell Biology 2023Quote: The anti-M6 antiserum #2 was generated by immunizing guinea pigs (Eurogentec) with the peptides GKGNNRDRIRDPRE and RRNSYRSDHSLDRYT (corresponding to aa 57–71 and 102–116 in M6 isoform F ...
-
bioRxiv - Molecular Biology 2020Quote: ... indirect immunofluorescence was performed using a custom generated polyclonal antibody raised against the ODA holocomplex (Eurogentec, 1:150 dilution) and an acetylated α-tubulin antibody (SantaCruz ...
-
bioRxiv - Plant Biology 2022Quote: ... The antibody against PsaA was raised using the following peptides STPEREAKKVKIAVDR and VKIAVDRNPVETSFEK and was obtained from Eurogentec (Belgium). Secondary antibodies for ECL detection were anti-rabbit (Invitrogen).
-
bioRxiv - Plant Biology 2021Quote: ... and polyclonal antibodies raised against phosphorylated S744 of NPH3 using peptide KPRRWRNpSIS (where pS represents phosphorylated serine) as antigen (Eurogentec). Blots were developed with horseradish peroxidase (HRP)-linked secondary antibodies (Promega ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Biochemistry 2021Quote: Localization studies were carried out using a rat antibody raised against purified recombinant Pf-int (aa 192-490) (Eurogentec, Belgium). Fixed parasites were spotted in each well of the microscopy slide and air-dried at RT in order to allow the parasites to adhere ...
-
bioRxiv - Biochemistry 2021Quote: Western blot analyses were carried out using a rat antibody raised against purified recombinant Pf-int (aa 192-490) (Eurogentec, Belgium). The protein content was transferred to a nitrocellulose membrane using the Trans Blot Turbo (BioRad ...
-
bioRxiv - Microbiology 2022Quote: ... The proteins were transferred on a nitrocellulose membrane and BfrG was detected by immunoblotting using a polyclonal antibody produced in guinea pig (Eurogentec, Belgium) at a 1:2,500 dilution ...
-
bioRxiv - Molecular Biology 2024Quote: ... Plates were washed again in TBS-T and 50 μl MSD® SULFO-TAG labelled streptavidin (1 μg ml-1) and biotinylated poly(GP) antibody (1 μg ml-1, Eurogentec) added per well diluted in blocking solution ...
-
bioRxiv - Microbiology 2023Quote: ... Native ΦKZ014 in infected cells was detected by Western blot (1:10k anti-ΦKZ014, Eurogentec, #1661 ...
-
bioRxiv - Molecular Biology 2020Quote: ... immunostaining Q22YU3Δ/SHULINΔ cells with a custom polyclonal anti-body against Shulin (Eurogentec, 1:100 dilution) confirmed loss of protein as well as serving as antibody validation (Figure S12C ...
-
bioRxiv - Cell Biology 2020Quote: ... A subset of fibers from passive and active experiments were prepared with one or more of the primary antibodies specific for various parts of I-band titin: PEVK (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:500 in PBS), N2A (polyclonal IgG ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...
-
bioRxiv - Neuroscience 2023Quote: The polyclonal sPrPY226 antibody was generated (upon structural prediction of Y226 as a potential shedding site) using an anti-peptide approach following a standard 87-day polyclonal protocol (Eurogentec, Belgium). Briefly ...