Labshake search
Citations for Eurogentec :
101 - 129 of 129 citations for Rabbit Follicle Stimulating Hormone FSH CLIA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: ... Reverse transcription was carried out with a reverse transcriptase kit (Eurogentec). Quantitative real-time PCR was performed using a Bio-Rad CFX (Bio-Rad Laboratories ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Cancer Biology 2020Quote: All reactions were performed with the qPCR Core Kit (Eurogentec, Seraing, Belgium) in a total reaction volume of 10 μl in 384-well plates ...
-
bioRxiv - Microbiology 2019Quote: ... using the Mesa Blue qPCR Mastermix Plus for Sybr assay kit (Eurogentec). Each reaction was performed in triplicate on three separate occasions ...
-
bioRxiv - Cell Biology 2020Quote: ... RNA (200 ng) was reverse transcribed using Reverse Transcription Core Kit (Eurogentec). Real-time PCR was performed in a 20 μL final volume using the Takyon No Rox SYBR kit (Eurogentec) ...
-
bioRxiv - Molecular Biology 2019Quote: ... For RT-qPCR the MESA Blue qPCR MasterMix Plus kit was used (Eurogentec). For each gene MESA Blue was mixed with 100nM forward and reverse primers (refer to table 2.2) ...
-
bioRxiv - Plant Biology 2020Quote: ... Quantitative real-time PCR (qPCR) using a SYBR Green core qPCR kit (Eurogentec) and an ABI Prism 7000 machine (Applied Biosystems ...
-
bioRxiv - Microbiology 2019Quote: ... Reverse transcription was completed using the Reverse Transcriptase Core kit (Eurogentec, Seraing, Belgium).
-
bioRxiv - Immunology 2023Quote: ... The mRNA was reverse transcribed using the Reverse Transcriptase Core Kit (Eurogentec, Liège, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Physiology 2019Quote: ... Purified total RNA (500 ng) was then reverse transcribed using Eurogentec Reverse Transcriptase Core Kit (Eurogentec) with both random and oligo-dT primers following manufacturer’s instructions ...
-
bioRxiv - Microbiology 2021Quote: ... Quantitative polymerase chain reaction (qPCR) was performed with the MESA BLUE qPCR kit for SYBR assay (Eurogentec) on a LightCycler96 system (Roche ...
-
bioRxiv - Plant Biology 2023Quote: ... We conducted qRT-PCRs with the Takyon No ROX SYBR MasterMix blue dTTP Kit (Eurogentec, Seraing, Belgium) in a LightCycler 480 II (Roche ...
-
bioRxiv - Plant Biology 2023Quote: ... by using the Takyon No ROX SYBR MasterMix blue dTTP kit (Cat. No. UF-NSMT-B0701; Eurogentec). Each amplification reaction was set up in a 10-μl reaction containing each primer at 300 nM and 1 μl of RT template in the case of total RNA with a thermal profile of 95°C for 10 min and 40 amplification cycles of 95°C ...
-
bioRxiv - Cell Biology 2020Quote: ... All quantitative polymerase chain reactions (qPCRs) were assembled using the MESA BLUE qPCR kit for SYBR assay (Eurogentec) according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2019Quote: qPCR on 100-fold diluted samples was performed using the Takyon ROX SYBR Mastermix blue dTTP kit (Eurogentec) and the StepOnePlus real time PCR system (Applied Biosystem) ...
-
bioRxiv - Plant Biology 2021Quote: ... qRT-PCR was performed us- ing the Takyon No ROX SYBR MasterMix blue dTTP Kit (Eurogentec, Seraing, Belgium) and the LightCycler 480 II (Roche ...
-
bioRxiv - Microbiology 2022Quote: ... qRT-PCR was performed in a Roche LightCycler 480 Instrument II using the Takyon LowROX SYBR kit (Eurogentec). All qRT-PCR experiments were conducted with 3 biological replicates and 3 technical replicates ...
-
bioRxiv - Developmental Biology 2021Quote: ... qPCR was performed using 7.5 µl of Takyon Rox SYBR Master mix blue dTTP kit (Eurogentec, UF-RSMT-B0701), 1.5 µl of cDNA and 0.5 µl of each 5µM primers (see Table 3) ...
-
bioRxiv - Microbiology 2022Quote: ... SYBR Green based Product Enhanced Reverse Transcriptase assay (SG-PERT) was performed using the Takyon SYBR green kit (Eurogentec) to quantify HCVpp titers used for infection (74).
-
bioRxiv - Cell Biology 2020Quote: ... Real-time PCR was performed in a 20 μL final volume using the Takyon No Rox SYBR kit (Eurogentec). Fluorescence intensity was recorded using a CFX96 Real-Time PCR Detection System (Bio-Rad ...
-
bioRxiv - Developmental Biology 2024Quote: ... qRT-PCR was performed using Takyon Rox SYBR 2x Master mix blue dTTP kit (Eurogentec Cat# UF-RSMT-B0701), with starting concentrations of template of around 10ng/µl and primer concentrations of 0.5µM ...
-
bioRxiv - Microbiology 2020Quote: ... Lentiviruses were titrated by SYBR green I-based real-time PCR-enhanced reverse transcriptase (SG-PERT) assay (29, 30) using the Takyon SYBR green kit (Eurogentec). The titer was determined by comparison with a standard curve of known RNA concentrations ...
-
bioRxiv - Microbiology 2020Quote: ... the microbial cultures were recovered and genomic DNA was isolated using the SmartExtract - DNA Extraction Kit (Eurogentec, Maastricht, The Netherlands). V ...
-
bioRxiv - Developmental Biology 2022Quote: ... The genomic DNA was purified from the hippocampal region of the brain tissues (∼10-12mg) using the smart extract-DNA extraction kit as per the supplier’s instruction (Cat# SKDNEX-100, Eurogentec, Belgium). The quantity of total genomic DNAs (gDNA ...
-
bioRxiv - Pathology 2024Quote: ... All reactions were performed in Biorad® 96-well plates with the reagent kit for TaqMan® qPCR assays (Eurogentec), in accordance with the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: ... first-strand cDNA synthesis (0.6 μg of total RNA per 15 μl reaction) was performed using olig-dT (Reverse Transcription Core Kit; Eurogentec, Seraing, Belgium). Real-time PCR was carried out with the Light Cycler Fast Start DNA Master SYBR Green Kit (Roche Applied Science ...
-
bioRxiv - Molecular Biology 2022Quote: ... A 25 μl reaction volume was prepared for each reaction using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: ... A 25 µl reaction volume was prepared for each reaction using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: ... a 20 µl mixture containing 3 µl of RNA was prepared using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...