Labshake search
Citations for Eurogentec :
51 - 100 of 168 citations for Rabbit Anti Enterovirus Polyclonal Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: Purified recombinant TbSmee1(1-400) was used for the generation of two polyclonal rabbit antisera (Eurogentec). Antisera (303 ...
-
bioRxiv - Biochemistry 2022Quote: ... the reaction was probed using the following antibodies: custom-made rabbit anti-Sch9-pSer288 (Eurogentec, 1:4’000), and goat anti-Sch9 (GenScript ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Molecular Biology 2020Quote: ... Antibody production in rabbit was done by Eurogentec (https://secure.eurogentec.com/eu-home.html) ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody’s affinity (Eurogentec; Peptide: 1911009, Rabbit 237) was confirmed through ELISA.
-
bioRxiv - Molecular Biology 2022Quote: ... anti-DnaD and anti- DnaB antibodies (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-DnaD and anti-DnaB antibodies (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Cell Biology 2024Quote: Anti-TbMyo1 antibodies were generated by immunisation of two rabbits with purified recombinant TbMyo1 (amino acids 729–1,168) (Eurogentec). For recombinant protein expression the TbMyo1 tail was cloned into a pET-28a(+ ...
-
bioRxiv - Biochemistry 2024Quote: ... Fractions were analysed by Western blotting using a 1/10,000 dilution of primary rabbit anti-FLAG® antibodies (Eurogentec) followed by a 1/5000 dilution of secondary donkey anti-rabbit IgG conjugated to HRP (Santa Cruz biotechnology ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Cell Biology 2021Quote: ... 2Y4824 rabbit anti-pre-immune serum (PIS; Eurogentec) was used for control purposes ...
-
bioRxiv - Molecular Biology 2020Quote: ... immunostaining Q22YU3Δ/SHULINΔ cells with a custom polyclonal anti-body against Shulin (Eurogentec, 1:100 dilution) confirmed loss of protein as well as serving as antibody validation (Figure S12C ...
-
bioRxiv - Molecular Biology 2020Quote: ... indirect immunofluorescence was performed using a custom generated polyclonal antibody raised against the ODA holocomplex (Eurogentec, 1:150 dilution) and an acetylated α-tubulin antibody (SantaCruz ...
-
bioRxiv - Cell Biology 2023Quote: ... Custom rabbit pAb anti-pS62 and anti-pT61-pS62 NDC80 were raised by Eurogentec using a 28-day protocol ...
-
bioRxiv - Plant Biology 2021Quote: ... and polyclonal antibodies raised against phosphorylated S744 of NPH3 using peptide KPRRWRNpSIS (where pS represents phosphorylated serine) as antigen (Eurogentec). Blots were developed with horseradish peroxidase (HRP)-linked secondary antibodies (Promega ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Antibodies against the H2A.W.6 phosphopeptide (CEEKATKSPVKSpPKKA) were raised in rabbits (Eurogentec) and purified by peptide affinity column ...
-
bioRxiv - Neuroscience 2022Quote: ... Rabbit anti-Mmt (Eurogentec, generated in this study, see below); and Mouse anti-NC82 (nc82 was deposited to the DSHB by Buchner ...
-
bioRxiv - Microbiology 2022Quote: ... The proteins were transferred on a nitrocellulose membrane and BfrG was detected by immunoblotting using a polyclonal antibody produced in guinea pig (Eurogentec, Belgium) at a 1:2,500 dilution ...
-
bioRxiv - Molecular Biology 2022Quote: ... because detection via our anti-DnaD antibody (Eurogentec) was not fully consistent between wild-type and variant alleles of dnaD ...
-
bioRxiv - Developmental Biology 2023Quote: ... 1.25μg anti-5mC antibody (Eurogentec BI-MECY-0100) and 10μL Dynabeads coupled with M-280 sheep anti-mouse antibody (Invitrogen) ...
-
bioRxiv - Neuroscience 2023Quote: The polyclonal sPrPY226 antibody was generated (upon structural prediction of Y226 as a potential shedding site) using an anti-peptide approach following a standard 87-day polyclonal protocol (Eurogentec, Belgium). Briefly ...
-
bioRxiv - Neuroscience 2019Quote: Primary antibodies: anti-CNK2 (guinea pig, Eurogentec, custom-made), anti-CNK2 (rabbit ...
-
bioRxiv - Microbiology 2020Quote: ... Primary antibody staining was carried out at room temperature for 1 hour with custom made AOX antibodies (Eurogentec; Peptide: 1911009, Rabbit 237), diluted to 1:1000 ...
-
bioRxiv - Genomics 2022Quote: Antibodies against H2A.Z.11 (KGLVAAKTMAANKDKC) and H2A.2 (CPKKAGSSKPTEED) peptides were raised in rabbits (Eurogentec) and purified by peptide affinity column ...
-
bioRxiv - Genomics 2023Quote: Antibodies against H2A.Z.11 (KGLVAAKTMAANKDKC) and H2A.2 (CPKKAGSSKPTEED) peptides were raised in rabbits (Eurogentec) and purified by a peptide affinity column ...
-
bioRxiv - Plant Biology 2019Quote: ... All the polyclonal antisera were affinity purified by Eurogentec. The immunodetection was performed with a chemiluminescent detection system kit (Pierce™ ECL Western Blotting Substrate ...
-
bioRxiv - Molecular Biology 2020Quote: ... Rabbit anti-AscA antiserum was produced using purified AscA by Eurogentec (Liège, Belgium). Rabbit anti-OmpF antiserum was a kind gift from T ...
-
bioRxiv - Cell Biology 2020Quote: ... A subset of fibers from passive and active experiments were prepared with one or more of the primary antibodies specific for various parts of I-band titin: PEVK (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:500 in PBS), N2A (polyclonal IgG ...
-
bioRxiv - Microbiology 2022Quote: ... 0.8 mg protein was used for raising two antibodies against KhpB in rabbit (Eurogentec, speedy program).
-
bioRxiv - Microbiology 2023Quote: Antibodies against BacA were raised by immunization of rabbits with purified BacA-His6 protein (Eurogentec, Belgium). Cells were harvested in the exponential growth phase ...
-
bioRxiv - Neuroscience 2024Quote: ... capture and detection antibody was the same affinity-purified custom anti-(GP)8 antibody (Eurogentec, biotinylated for detector). For polyGA ...
-
bioRxiv - Molecular Biology 2023Quote: ... The anti-AGO1-N-coil antibody was affinity purified by Eurogentec from sera collected from a rabbit immunized with a 16-amino acid peptide from the N-coil of AGO1 (F177-C192 ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2019Quote: ... Anti-OmpA antibody54 was used at 1:20,000 and a custom anti-TssL antibody (Eurogentec; see Supplementary Fig. 8) was used at 1:6,000 ...
-
bioRxiv - Neuroscience 2024Quote: ... The following antibodies were used: anti-poly(GP) (GP658, custom-made from Eurogentec) and anti-poly(GA ...
-
bioRxiv - Molecular Biology 2019Quote: ... The primary antibodies used in this study were raised in rabbit against a peptide sequence from the ZFD of RelA (Eurogentec). Next ...
-
bioRxiv - Cell Biology 2023Quote: Crb3 homeolog L and S specific antibodies were obtained by immunizing rabbits using the speedy protocol from Eurogentec (Seraing, Belgium). The synthetic peptides identical to the ectodomain of Crb3.L (H-QNVTTSAPDRLSESAR-C ...
-
bioRxiv - Genomics 2023Quote: ... The anti-RpHEI10 was a combination of two antibodies raised in rabbits against the peptides CNRPNQSRARTNMFQL and CPVRQRNNKSMVSGGP (gene ID: RP3G01271190/RP3G01008630/RP1G00269340/RP2G00699130) and affinity-purified (Eurogentec). Each primary antibody was diluted 1:200 in blocking solution ...
-
bioRxiv - Genomics 2023Quote: ... The anti-RpREC8 was a combination of two antibodies raised in rabbits against the peptides CEEPYGEIQISKGPNM and CYNPDDSVERMRDDPG (gene ID: RP1G00316120/RP2G00915110/RP4G01319620/RP5G01638170) and affinity-purified (Eurogentec). The anti-RpHEI10 was a combination of two antibodies raised in rabbits against the peptides CNRPNQSRARTNMFQL and CPVRQRNNKSMVSGGP (gene ID ...
-
bioRxiv - Biochemistry 2023Quote: ... C+IVAPGEARLGSIKMA for bGIC-1 and C+TAAEGRISGMAIAKS for bGIC-2) were generated as a N-terminal Keyhole limpet haemocyanin fusion to raise the antibodies in rabbits (Eurogentec). For Western blots ...
-
bioRxiv - Molecular Biology 2022Quote: ... After an overnight incubation at 4°C with the primary antibodies (anti-5mC, Eurogentec, ref BI-MECY-0100 ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-non-muscle myosin heavy chain II-A (NMIIA) (1:1000; PRB-440P-050, Eurogentec, Liege, Belgium), mouse anti-α-actinin (1:800 ...
-
bioRxiv - Molecular Biology 2024Quote: A poly(GP) Meso Scale Discovery (MSD®) enzyme-linked immunosorbent assay (ELISA) was established using a custom made rabbit αLGP antibody (Eurogentec) and based on previously described methods16 ...
-
Incidence of an intracellular multiplication niche amongst Acinetobacter baumannii clinical isolatesbioRxiv - Microbiology 2021Quote: ... using a lyophilized preparation and a speedy-immunization polyclonal program (BIOTEM, France; Eurogentec, Belgium). The anti-A ...
-
bioRxiv - Neuroscience 2020Quote: Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin (Eurogentec, 1/50) and rabbit anti-neurofilament antibodies (Eurogentec ...