Labshake search
Citations for Eurogentec :
51 - 90 of 90 citations for Phospho p95 NBS1 S343 Rabbit Recombinant mAb since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
Cultivation and characterization of human midbrain organoids in sensor integrated microfluidic chipsbioRxiv - Bioengineering 2019Quote: ... The following first antibodies were used: anti-rabbit Tuj1 (Optim AB Eurogentec, 1:600); anti-rabbit TH (SantaCruz ...
-
bioRxiv - Cell Biology 2020Quote: ... LecA was detected by a custom-made polyclonal rabbit anti-LecA antibody (Eurogentec, France).
-
bioRxiv - Evolutionary Biology 2021Quote: ... lobularis were obtained by immunizing rabbits using the speedy protocol from Eurogentec (Seraing, Belgium) with a synthetic peptide (QTISDPGEEDPPVSKC ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa40-59 JCPyV agno-sera (generated on request by Eurogentec, Belgium), polyconal anti-BKPyV agnosera (generous gift from C ...
-
bioRxiv - Neuroscience 2023Quote: ... Guinea pig anti-EAAT5b and rabbit anti-EAAT7 antibodies were column purified by Eurogentec.
-
bioRxiv - Cell Biology 2023Quote: ... Custom rabbit pAb anti-pS62 and anti-pT61-pS62 NDC80 were raised by Eurogentec using a 28-day protocol ...
-
bioRxiv - Genomics 2022Quote: Antibodies against H2A.Z.11 (KGLVAAKTMAANKDKC) and H2A.2 (CPKKAGSSKPTEED) peptides were raised in rabbits (Eurogentec) and purified by peptide affinity column ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa40-53 BKPyV agno-sera (generated on request by Eurogentec, clone 1163), polyclonal rabbit anti-BKPyV LTag sera (generous gift from C ...
-
bioRxiv - Genomics 2023Quote: Antibodies against H2A.Z.11 (KGLVAAKTMAANKDKC) and H2A.2 (CPKKAGSSKPTEED) peptides were raised in rabbits (Eurogentec) and purified by a peptide affinity column ...
-
bioRxiv - Biochemistry 2024Quote: The expression and cellular localization of BT4244 M60L was determined using rabbit polyclonal antibodies (Eurogentec) generated against a purified recombinant version of the protein lacking the lipoprotein signal sequence ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa52-66 BKPyV agno-sera (generated on request by Eurogentec, Belgium, clone 753), polyclonal rabbit anti-aa40-53 BKPyV agno-sera (generated on request by Eurogentec ...
-
bioRxiv - Microbiology 2022Quote: ... 0.8 mg protein was used for raising two antibodies against KhpB in rabbit (Eurogentec, speedy program).
-
bioRxiv - Neuroscience 2023Quote: ... Capture antibodies were: our previously described custom rabbit anti-(GR)7 antibody (Eurogentec 2 µg/mL) 90 ...
-
bioRxiv - Microbiology 2023Quote: Antibodies against BacA were raised by immunization of rabbits with purified BacA-His6 protein (Eurogentec, Belgium). Cells were harvested in the exponential growth phase ...
-
bioRxiv - Biochemistry 2022Quote: ... the reaction was probed using the following antibodies: custom-made rabbit anti-Sch9-pSer288 (Eurogentec, 1:4’000), and goat anti-Sch9 (GenScript ...
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-non-muscle myosin heavy chain II-A (NMIIA) (1:1000; PRB-440P-050, Eurogentec, Liege, Belgium), mouse anti-α-actinin (1:800 ...
-
bioRxiv - Neuroscience 2023Quote: ... The synthetic peptide was conjugated to keyhole limpet hemocyanin for immunization of rabbits and guinea pigs (Eurogentec, Belgium). Resulting sera were affinity-purified on the peptide antigen and the specificity of the resulting antibodies was confirmed using lysates and tissue sections from Rbm20 knock-out mice.
-
bioRxiv - Developmental Biology 2019Quote: ... peptides corresponding to the amino-terminal region and internal region of the Gβ13F protein were commercially synthesized and used to immunize rabbits (Eurogentec). The peptide sequences employed were as follows ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Biochemistry 2024Quote: ... Fractions were analysed by Western blotting using a 1/10,000 dilution of primary rabbit anti-FLAG® antibodies (Eurogentec) followed by a 1/5000 dilution of secondary donkey anti-rabbit IgG conjugated to HRP (Santa Cruz biotechnology ...
-
bioRxiv - Cell Biology 2021Quote: ... were digested with Prescission protease (Amersham Pharmacia Biotech) and used to produce monoclonal antibodies as described42 and to raise polyclonal rabbit antiserum #4457 (Eurogentec). The NHSL1 monoclonal antibody was subcloned twice (clone C286F5E1 ...
-
bioRxiv - Molecular Biology 2019Quote: ... The primary antibodies used in this study were raised in rabbit against a peptide sequence from the ZFD of RelA (Eurogentec). Next ...
-
bioRxiv - Cell Biology 2023Quote: Crb3 homeolog L and S specific antibodies were obtained by immunizing rabbits using the speedy protocol from Eurogentec (Seraing, Belgium). The synthetic peptides identical to the ectodomain of Crb3.L (H-QNVTTSAPDRLSESAR-C ...
-
bioRxiv - Genomics 2023Quote: ... The anti-RpHEI10 was a combination of two antibodies raised in rabbits against the peptides CNRPNQSRARTNMFQL and CPVRQRNNKSMVSGGP (gene ID: RP3G01271190/RP3G01008630/RP1G00269340/RP2G00699130) and affinity-purified (Eurogentec). Each primary antibody was diluted 1:200 in blocking solution ...
-
bioRxiv - Genomics 2023Quote: ... The anti-RpREC8 was a combination of two antibodies raised in rabbits against the peptides CEEPYGEIQISKGPNM and CYNPDDSVERMRDDPG (gene ID: RP1G00316120/RP2G00915110/RP4G01319620/RP5G01638170) and affinity-purified (Eurogentec). The anti-RpHEI10 was a combination of two antibodies raised in rabbits against the peptides CNRPNQSRARTNMFQL and CPVRQRNNKSMVSGGP (gene ID ...
-
bioRxiv - Microbiology 2023Quote: ... Protein samples were analyzed by SDS-PAGE to determine purity prior to their use for immunization in rabbits for the generation of an affinity purified polyclonal antibody (Eurogentec).
-
bioRxiv - Microbiology 2023Quote: ... the anti-KhpB was generated with a synthesized peptide derived from C- terminus of KhpB protein (H-CGRDPKRYIVIKKKRG-OH) in rabbits (Eurogentec). The KhpB anti- serum was tested with ELISA assay and further cleaned with affinity purification ...
-
bioRxiv - Microbiology 2023Quote: ... recombinantly produced EF-P was purified and sent to Eurogentec for polyclonal antibody generation (Speedy 28-day program in rabbits, Eurogentec). The blood serum containing antibodies against the R ...
-
bioRxiv - Microbiology 2023Quote: Polyclonal antisera against ComG pilins were produced by immunising rabbits with a mixture of two different peptides that were synthesised from each protein (Eurogentec). Peptides corresponding to the following residues in mature pilins were used ...
-
bioRxiv - Biochemistry 2023Quote: ... C+IVAPGEARLGSIKMA for bGIC-1 and C+TAAEGRISGMAIAKS for bGIC-2) were generated as a N-terminal Keyhole limpet haemocyanin fusion to raise the antibodies in rabbits (Eurogentec). For Western blots ...
-
bioRxiv - Developmental Biology 2020Quote: DILP2 peptide corresponding to the sequence TRQRQGIVERC (amino acids 108-118) was used as an immunogen to raise DILP2 polyclonal antibody in rabbit (Eurogentec, Belgium). Mouse anti-GFP (Cat ...
-
bioRxiv - Neuroscience 2020Quote: Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin (Eurogentec, 1/50) and rabbit anti-neurofilament antibodies (Eurogentec ...
-
bioRxiv - Plant Biology 2021Quote: A solution containing 3.5 mg of purified recombinant LbGH28A protein was used to elicit the production of polyclonal antibodies in rabbit according to the manufacturer’s procedure (Eurogentec, Seraing, Belgium). The indirect immunofluorescent (IIF ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Molecular Biology 2024Quote: A poly(GP) Meso Scale Discovery (MSD®) enzyme-linked immunosorbent assay (ELISA) was established using a custom made rabbit αLGP antibody (Eurogentec) and based on previously described methods16 ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mg of the peptide was coupled with the carrier protein KHL (Keyhole Limpet Hemocyanin) and was subsequently used to inoculate a rabbit (through the Eurogentec’s speedy program) for antibody production ...
-
bioRxiv - Microbiology 2020Quote: ... Primary antibody staining was carried out at room temperature for 1 hour with custom made AOX antibodies (Eurogentec; Peptide: 1911009, Rabbit 237), diluted to 1:1000 ...
-
bioRxiv - Microbiology 2022Quote: ... The proteins were injected into rabbits to generate polyclonal antibodies according to standard protocols (His-GspD, Cocalico, Reamstown, PA; His-PilQOlut, Eurogentec, Seraing, BE). Sera were tested for cross-reactivity by immunoblotting lysates from wildtype M ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...