Labshake search
Citations for Eurogentec :
51 - 100 of 147 citations for Goat Anti Poliovirus Polyclonal Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: ... Guinea pig anti-EAAT5b and rabbit anti-EAAT7 antibodies were column purified by Eurogentec.
-
bioRxiv - Plant Biology 2019Quote: ... Polyclonal rabbit antisera were obtained from Eurogentec (Seraing, B), raised against the N-terminal GPT sequences (91 amino acids of GPT1 or 92 amino acids of GPT2 ...
-
bioRxiv - Plant Biology 2019Quote: ... All the polyclonal antisera were affinity purified by Eurogentec. The immunodetection was performed with a chemiluminescent detection system kit (Pierce™ ECL Western Blotting Substrate ...
-
bioRxiv - Neuroscience 2023Quote: ... Capture antibodies were: our previously described custom rabbit anti-(GR)7 antibody (Eurogentec 2 µg/mL) 90 ...
-
bioRxiv - Cell Biology 2020Quote: ... A subset of fibers from passive and active experiments were prepared with one or more of the primary antibodies specific for various parts of I-band titin: PEVK (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:500 in PBS), N2A (polyclonal IgG ...
-
bioRxiv - Biochemistry 2023Quote: Polyclonal rabbit antiserum against TbPam16 was commercially produced (Eurogentec, Belgium) using amino acids 153-167 (VKDSHGNSRGNDAMW ...
-
bioRxiv - Neuroscience 2024Quote: ... capture and detection antibody was the same affinity-purified custom anti-(GP)8 antibody (Eurogentec, biotinylated for detector). For polyGA ...
-
bioRxiv - Molecular Biology 2023Quote: ... The anti-AGO1-N-coil antibody was affinity purified by Eurogentec from sera collected from a rabbit immunized with a 16-amino acid peptide from the N-coil of AGO1 (F177-C192 ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Cell Biology 2021Quote: NCAPH2: Rabbit polyclonal produced on demand by Eurogentec (WB:1/1000).
-
bioRxiv - Microbiology 2022Quote: Polyclonal IgGs were developed in New Zealand White Rabbits (Eurogentec, Belgium) as per the company’s protocol ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2019Quote: ... Anti-OmpA antibody54 was used at 1:20,000 and a custom anti-TssL antibody (Eurogentec; see Supplementary Fig. 8) was used at 1:6,000 ...
-
bioRxiv - Neuroscience 2024Quote: ... The following antibodies were used: anti-poly(GP) (GP658, custom-made from Eurogentec) and anti-poly(GA ...
-
bioRxiv - Neuroscience 2019Quote: ... Tibialis anterior muscles were dissected into bundles and processed for immunofluorescence using a combination of rabbit anti-synaptophysin and rabbit anti-neurofilament antibodies (Eurogentec) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Biochemistry 2021Quote: ... The polyclonal TbUbL1 rabbit antisera used for immunoblots was produced commercially by Eurogentec using peptide sequence CSEISGNHRSSEHNAG ...
-
Cultivation and characterization of human midbrain organoids in sensor integrated microfluidic chipsbioRxiv - Bioengineering 2019Quote: ... The following first antibodies were used: anti-rabbit Tuj1 (Optim AB Eurogentec, 1:600); anti-rabbit TH (SantaCruz ...
-
bioRxiv - Molecular Biology 2022Quote: ... After an overnight incubation at 4°C with the primary antibodies (anti-5mC, Eurogentec, ref BI-MECY-0100 ...
-
Incidence of an intracellular multiplication niche amongst Acinetobacter baumannii clinical isolatesbioRxiv - Microbiology 2021Quote: ... using a lyophilized preparation and a speedy-immunization polyclonal program (BIOTEM, France; Eurogentec, Belgium). The anti-A ...
-
bioRxiv - Plant Biology 2020Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Plant Biology 2022Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Cell Biology 2023Quote: Purified recombinant TbSmee1(1-400) was used for the generation of two polyclonal rabbit antisera (Eurogentec). Antisera (303 ...
-
bioRxiv - Genomics 2020Quote: ... 1.25 µl of mouse anti-human 5mC antibody (clone 33D3; Eurogentec Ltd., Cat No. BI-MECY, RRID:AB_2616058), and 10 µl of Dynabeads coupled with M-280 sheep anti-mouse IgG bead (Invitrogen) ...
-
bioRxiv - Biochemistry 2022Quote: ... the reaction was probed using the following antibodies: custom-made rabbit anti-Sch9-pSer288 (Eurogentec, 1:4’000), and goat anti-Sch9 (GenScript ...
-
bioRxiv - Genomics 2019Quote: ... 0.05% Triton X-100) using 1 µl of mouse monoclonal anti-5-methylcytosine antibody (Eurogentec BI-MECY-0100) or 0,5 µl of rabbit 5-Hydroxymethylcytosine antibody (Active motif 39769) ...
-
bioRxiv - Molecular Biology 2022Quote: ... Anti-DHX34 is a peptide-specific antibody raised against human DHX34 obtained from Eurogentec (Hug and Cáceres 2014). For Immunopurifications GFP-Trap-MA beads (Chromotek ...
-
bioRxiv - Biochemistry 2023Quote: ... Membranes were then overnight incubated at 4°C with the anti-HA primary antibody (OptimAb HA. 11, Eurogentec), which was raised from mouse serum ...
-
bioRxiv - Cell Biology 2024Quote: Anti-TbMyo1 antibodies were generated by immunisation of two rabbits with purified recombinant TbMyo1 (amino acids 729–1,168) (Eurogentec). For recombinant protein expression the TbMyo1 tail was cloned into a pET-28a(+ ...
-
bioRxiv - Biochemistry 2024Quote: ... Fractions were analysed by Western blotting using a 1/10,000 dilution of primary rabbit anti-FLAG® antibodies (Eurogentec) followed by a 1/5000 dilution of secondary donkey anti-rabbit IgG conjugated to HRP (Santa Cruz biotechnology ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Cell Biology 2021Quote: ... and washed with PBS before blocking and primary antibody incubation (mouse-anti 5-methycytosine, Eurogentec, BI-MECY-0100, 1:250). After PBS washes ...
-
bioRxiv - Cell Biology 2022Quote: ... with 5% non-fat dry milk for 30 min and incubated with anti-HA primary antibody (1:5,000, Eurogentec 16B12) or anti-Pgk1 primary antibody (1:5,000 ...
-
bioRxiv - Molecular Biology 2020Quote: Custom-made antibodies (Eurogentec) against endogenous PIWI proteins were generated by immunization of two rabbits per antibody with a mix of two unique peptides (Ago3 ...
-
bioRxiv - Genomics 2024Quote: ... filiformis ParB antibody (Eurogentec) with a 1:1000 dilution ...
-
bioRxiv - Genomics 2024Quote: ... oneisti ParB antibody (Eurogentec). All primary antibodies were incubated in blocking solution overnight at 4°C ...
-
bioRxiv - Molecular Biology 2022Quote: ... membranes were blocked in 5% milk PBS-T (1X PBS buffer with 0.1% Tween-20) and incubated overnight at 4°C with one of the following antibodies: anti-HA.11 (1:2,000; Eurogentec, Cat# MMS-101P-500), anti-Stm1 (1:10,000 ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Molecular Biology 2022Quote: ... Antibodies were purchased from Eurogentec. Plasmid extractions were performed using Qiagen miniprep kits ...
-
bioRxiv - Molecular Biology 2022Quote: ... Antibodies were purchased from Eurogentec. Plasmid extractions were performed using Qiagen miniprep kits ...
-
bioRxiv - Cancer Biology 2019Quote: ... KLK4/KLKP1 (Eurogentec custom synthesized antibody) and β-actin (Sigma ...
-
bioRxiv - Microbiology 2021Quote: ... Antibodies against TfcP were generated by Eurogentec against TfcPΔ1-18-His6 purified from E ...
-
bioRxiv - Cell Biology 2020Quote: ... All antibodies were custom made by Eurogentec.
-
bioRxiv - Molecular Biology 2021Quote: ... The OptimAb HA.11 monoclonal antibody (Eurogentec) was used to detect hemagglutinin (HA)-fusion proteins at the concentration of 0.5 μg/ml ...
-
bioRxiv - Neuroscience 2023Quote: ... an ASPM antibody was generated by Eurogentec by using a 16 amino acid peptide (ac-SVSQKVDRVRSPLQAC-con ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody was produced by Eurogentec (Seraing, Belgium).
-
bioRxiv - Molecular Biology 2020Quote: ... Antibody production in rabbit was done by Eurogentec (https://secure.eurogentec.com/eu-home.html) ...
-
bioRxiv - Microbiology 2020Quote: ... The antibody’s affinity (Eurogentec; Peptide: 1911009, Rabbit 237) was confirmed through ELISA.
-
bioRxiv - Microbiology 2020Quote: ... Primary antibody staining was carried out at room temperature for 1 hour with custom made AOX antibodies (Eurogentec; Peptide: 1911009, Rabbit 237), diluted to 1:1000 ...
-
bioRxiv - Microbiology 2020Quote: ... Primary antibodies against Hcp (Eurogentec; Metzger et al., 2016) were used at 1:5,000 dilution while anti-Sigma70-HRP antibodies (BioLegend ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...