Labshake search
Citations for Eurogentec :
51 - 100 of 127 citations for 7 Methyl 1 2 3 4 tetrahydroisoquinoline since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2023Quote: Antibodies against H2A.Z.11 (KGLVAAKTMAANKDKC) and H2A.2 (CPKKAGSSKPTEED) peptides were raised in rabbits (Eurogentec) and purified by a peptide affinity column ...
-
bioRxiv - Microbiology 2019Quote: An MHC I class-restricted peptide from YFV-17D non-structural protein 3 (NS3) (sequence ATLTYRML) (57) was synthetized by Eurogentec (Seraing, Belgium). Total cellular antigen for YFV-17D and JEV SA14-14-2 was prepared first by infecting Vero E6 cells with 0.1 MOI YFV-17D or JEV SA14-14-2 ...
-
bioRxiv - Plant Biology 2024Quote: ... 4 µl of the diluted cDNA was used together with Takyon No Rox SYBR MasterMix dTTP Blue (Eurogentec, Seraing, Belgium). AT3G01150 was chosen as reference gene (Czechowski et al. ...
-
bioRxiv - Microbiology 2023Quote: ... a 20 µl mixture containing 3 µl of RNA was prepared using the Low ROX One-Step qRT-PCR 2X MasterMix kit (Eurogentec®, Seraing, Belgium) following the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2024Quote: ... SMI312 (Eurogentec, 1:500), synaptophysin 1 (SySy ...
-
bioRxiv - Cell Biology 2021Quote: ... We amplified 4 µL cDNA (50 ng) using 10 µL of Takyon™ No Rox SYBR MasterMix Blue dTTP (Eurogentec, Liege, Belgium), 2 µL of each reverse and forward primers (10 mM) ...
-
bioRxiv - Immunology 2022Quote: ... then 100 ng/ml of synthetic competence-stimulating peptide 1 (CSP-1; Eurogentec) was added for 12min at 37°C to activate transformation machinery ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Microbiology 2021Quote: ... and the products were run on a 2% agarose gel at 100 V for 30 mins alongside the 100-1000 bp DNA Ladder (SmartLadder-SF, Eurogentec).
-
bioRxiv - Biochemistry 2023Quote: ... C+IVAPGEARLGSIKMA for bGIC-1 and C+TAAEGRISGMAIAKS for bGIC-2) were generated as a N-terminal Keyhole limpet haemocyanin fusion to raise the antibodies in rabbits (Eurogentec). For Western blots ...
-
bioRxiv - Microbiology 2024Quote: An amount of 2 μL of cDNA was then used for quantitative PCR with the MESA GREEN qPCR MasterMix Plus (Eurogentec) and primers for AID (Forward 5′ AATTCAAAAATGTCCGCTGGGC*T3′ ...
-
bioRxiv - Cancer Biology 2024Quote: ... Metaphases were denatured at 72°C in 70% formamide/30% 2xSSC solution for 2 min before hybridization to Alexa 488–OO-(CCCTAA)n probe (Eurogentec) at 37°C for 16 hours ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Genetics 2022Quote: ... containing 1× PCR buffer (Silverstar, Eurogentec), 1.5 mm MgCl2 ...
-
bioRxiv - Genetics 2023Quote: ... H3 (1:10,000) (AS- 61704, Eurogentec), α-tubulin (1:5,000 ...
-
bioRxiv - Cell Biology 2019Quote: ... Relative copy numbers of the single-copy nuclear-encoded gene beta-2-microglobulin (β2M) and the mitochondrially-encoded gene mtND1 were measured by quantitative (Q)-PCR using SYBR Green Mastermix (Eurogentec Ltd.) and the DNA Engine Opticon 2 system (BioRad) ...
-
bioRxiv - Immunology 2020Quote: ... The expression of the genes of hexokinase 2 (HK2) and LDH-A was determined using PCR SYBR Green sequence detection system (Eurogentec, Seraing, Belgium) and the CFX Connect™ Real-Time PCR Detection System (Bio-Rad ...
-
bioRxiv - Physiology 2019Quote: ... and each sample was run in triplicate with 2 µL of the diluted cDNA and 8 µL of master mix containing 1x qPCR MasterMix Plus Low ROX (Eurogentec, Liège, Belgium) or 1x TaqMan gene expression MasterMix (Thermo Fisher Scientific ...
-
bioRxiv - Microbiology 2022Quote: ... 1 µl of these cultures were then placed onto 1 % (w/v) molecular biology-grade agarose (Eurogentec, Belgium) pads containing ddH2O (snap shots ...
-
bioRxiv - Biochemistry 2021Quote: Anti-TRPM7 2C7 mouse monoclonal antibody (anti-M7d, Figure 1-figure supplement 1) was produced by Eurogentec (Belgium) as follows ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.2 (1661, rabbit, 1:10k, Eurogentec, produced against peptide TEYDRNHGWNIREKH ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ΦKZ014.1 (1660, rabbit, 1:10k, Eurogentec, produced against peptide EQYGESDDTSDESSY ...
-
bioRxiv - Microbiology 2023Quote: ... subtilis Rho (Eurogentec, Belgium; dilution 1:5,000) and the secondary peroxidase-coupled anti-rabbit IgG antibodies A0545 (Sigma-Aldrich ...
-
bioRxiv - Genomics 2023Quote: ... 1 μM Template-Switching Oligo (TSO, Eurogentec), 1 mM dNTP mix (Roche) ...
-
bioRxiv - Cell Biology 2021Quote: ... or PLEKHA6 (RtSZR127, IB: 1/1000, IF,IHC: 1/100) were generated by immunization of rats (Polyclonal Antibody Production, Eurogentec) with purified N-terminally GST- fused C-terminal fragments of human PLEKHA5 (NP_061885 ...
-
bioRxiv - Microbiology 2022Quote: ... The membrane was blocked with PBS + 5% milk for 1 hour at room temperature then incubated with a PBS + 1% milk solution containing a 1:2000 polyclonal anti-DnaA antibody (Eurogentec) for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2024Quote: ... hepatica cathepsin L1 pro-peptide (rFhCL1pp; 1:500 dilution, non-related control) and pre-immune anti-rFhCL1pp (1:500 dilution) (Eurogentec). Parasite sections were incubated at RT for five hours in a humid container ...
-
bioRxiv - Neuroscience 2020Quote: ... and rabbit anti-neurofilament antibodies (Eurogentec, 1/50) followed by an Alexa-conjugated donkey anti-rabbit 488 (Jackson ...
-
bioRxiv - Microbiology 2020Quote: ... Real-time qPCR was conducted on a Stepone plus real-time PCR system from Applied Biosystems using specific primers (Table 1) (Eurogentec, Seraing, Belgium), SYBR green reagents and ROX reference dye (Thermo Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... Guinea pig anti-TPI-GAPDH (1:1000; Eurogentec), previously shown to localise in the mitochondria (Bártulos etLJal. ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Genomics 2021Quote: ... in a final volume of 10 µL (0.5 µL of each primer, 5 µL of Eurogentec Takyon™ SYBR® 2 x qPCR Mastermix Blue). The following Light-Cycler run protocol was used ...
-
bioRxiv - Genetics 2021Quote: ... Milk was renewed and added 1/200 antibody (Eurogentec) against AGO104 or AGO105/AGO119 and left overnight with agitation ...
-
bioRxiv - Cancer Biology 2022Quote: ... supplemented with 1 µM human gp100 (25-33) (Eurogentec) and 50 U/mL IL-2 (PeproTech ...
-
bioRxiv - Plant Biology 2022Quote: ... and α-BAK1 (1/5,000; custom-made by Eurogentec). For the uncropped blots see Figure S3.
-
bioRxiv - Cell Biology 2021Quote: cy3-BHQ2 pre-miR-181a-1 molecular beacon (Eurogentec): 5’-CAUUGCCUUUAGAUACCAAUG -3’ ...
-
bioRxiv - Microbiology 2022Quote: ... A 1-kb DNA ladder (Smartladder, Eurogentec, Seraing, Belgium) was added as a reference marker ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-FPN antibody (1:2,000, Eurogentec, NRU 451443), rabbit anti-FTH (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... 0,25 µM end concentration probe (Supplementary table 1, Eurogentec) and nuclease free water ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Cell Biology 2021Quote: NCAPH2: Rabbit polyclonal produced on demand by Eurogentec (WB:1/1000).
-
bioRxiv - Microbiology 2020Quote: DNA oligonucleotides (Table 1) for CD analysis were obtained from Eurogentec (Belgium), supplied at 1000 nmol scale ...
-
bioRxiv - Cell Biology 2019Quote: Oligonucleotides encoding P2A and homologous sequences were purchased from Eurogentec (table 1). P2A was substituted for T2A using the PCR Geiser method [22] ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... supernatants (1 μg/mL of lysate) were treated with DNAse I (Eurogentec) for 1 hour on ice ...
-
bioRxiv - Neuroscience 2019Quote: ... Primers (detailed in Supplementary data, Supplementary Table 1) were purchased from Eurogentec (France).
-
bioRxiv - Microbiology 2019Quote: ... 1.25 μL of 10 μM primers (reported in Table 1) (Eurogentec, Seraing, Belgium) and 1.25 μL of water ...
-
bioRxiv - Immunology 2020Quote: ... qPCR assays were performed using primers purchased from Eurogentec (Seraing, Belgium; Table 1) and specific for the gene coding for the flaA and flaB subunit genes ...
-
bioRxiv - Synthetic Biology 2022Quote: ... with Highlighter plasmids in 1 mm electroporation cuvettes (Eurogentec, Cat#CE-0001-50) using an Eppendorf Multiporator (Cat#4308 ...
-
bioRxiv - Biophysics 2023Quote: ... cavin-1/PTRF (L-012807-02-0005) or control RNAi SR-CL000 (Eurogentec) was used at 100 nM via magnetofection technology (OZ Biosciences ...
-
Cultivation and characterization of human midbrain organoids in sensor integrated microfluidic chipsbioRxiv - Bioengineering 2019Quote: ... The following first antibodies were used: anti-rabbit Tuj1 (Optim AB Eurogentec, 1:600); anti-rabbit TH (SantaCruz ...