Labshake search
Citations for Avanti Polar Lipids :
301 - 350 of 908 citations for DOLICHOL FROM BOVINE HEART since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2024Quote: The following synthetic lipids were acquired from Avanti Polar Lipids unless otherwise specified:
-
bioRxiv - Biophysics 2024Quote: Synthetic lipids were purchased from Avanti Polar Lipids (Alabaster, AL). Carboxyfluorescein (CF ...
-
bioRxiv - Biochemistry 2024Quote: Lipid vesicles were prepared using lipids from Avanti Polar Lipids, USA ...
-
bioRxiv - Synthetic Biology 2024Quote: ... (cat #840475) in chloroform were purchased from Avanti Polar Lipids. The membrane dye DiD (1,1’-Dioctadecyl-3,3,3’,3’-Tetramethylindodicarbocyanine ...
-
bioRxiv - Systems Biology 2024Quote: ... Authentic standards for sample preparation were from Avanti Polar Lipids Inc ...
-
bioRxiv - Biophysics 2024Quote: ... the following lipids were purchased from Avanti Polar Lipids (USA): 1-oleoyl-2-myristoyl-sn-glycero-3-phosphocholine (OMPC) ...
-
bioRxiv - Biophysics 2024Quote: ... All other lipids were purchased from Avanti Polar Lipids (USA). The multilamellar membranes were produced by drying 10μL of the lipid mixtures in glass vials under vacuum for 1 hour before rehydrating in 500μL buffer (either HBS or HBS+Ca) ...
-
bioRxiv - Biochemistry 2024Quote: Lipids and internal standards were purchased from Avanti Polar Lipids. For storage ...
-
bioRxiv - Immunology 2024Quote: ... and LPI with 18:0 (all from Avanti Polar Lipids)].
-
bioRxiv - Cell Biology 2024Quote: Lipid standards were from Avanti Polar Lipids (Alabaster, AL, USA). Solvents for extraction and MS analyses were liquid chromatography grade (Merck ...
-
bioRxiv - Neuroscience 2024Quote: ... and 25 μL serum was precipitated using 75 μL of a precipitation solution made from isopropanol (IPA) supplemented with 14 isotopically labeled internal standards (IS) from Avanti Polar Lipids (Alabama, AL, USA). The IS included were cholesterol (d7) ...
-
bioRxiv - Biophysics 2021Quote: ... and cholesterol (CH) were purchased from Avanti Polar Lipids (Alabaster, AL). Texas Red-1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (TR-DHPE) ...
-
bioRxiv - Biophysics 2020Quote: Dipalmitoylphosphatidyl choline (DPPC) and Dehydroergosterol were purchased from Avanti Polar Lipids Inc ...
-
bioRxiv - Biophysics 2022Quote: ... and DSEP-PEG(2000) Biotin were purchased from Avanti Polar Lipids, Inc ...
-
bioRxiv - Biochemistry 2020Quote: Phospholipids were obtained from (Avanti polar lipids Inc, Alabaster, AL, USA), and brassicasterol (CarboSynth ...
-
bioRxiv - Immunology 2021Quote: αGC stock was received at 2mg/mL from Avanti Polar Lipids, Alabaster ...
-
bioRxiv - Biophysics 2020Quote: All lipids were purchased from Avanti Polar Lipids (Alabaster, AL, USA). Water (HPLC grade) ...
-
bioRxiv - Biochemistry 2021Quote: ... and SPLASH® LIPIDOMIX® were purchased from Avanti Polar Lipids (Avanti Polar Lipids ...
-
bioRxiv - Biochemistry 2020Quote: ... and Cholesterol (d7) was purchased from Avanti Polar Lipids (Alabaster, AL).
-
bioRxiv - Biochemistry 2020Quote: ... Phosphatidylinositol 4 5-bisphosphate (PIP2) was purchased from Avanti polar lipids.
-
bioRxiv - Bioengineering 2021Quote: All lipids and extrusion supplies were purchased from Avanti Polar Lipids. A lipid solution consisting of 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC) ...
-
bioRxiv - Biochemistry 2020Quote: ... coli lipids (acetone/ether precipitated) were purchased from Avanti Polar Lipids, Inc ...
-
bioRxiv - Biophysics 2021Quote: DOPC and DGS-NTA(Ni2+) were purchased from Avanti Polar Lipids. Texas red 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (TR-DHPE ...
-
bioRxiv - Biophysics 2020Quote: ... The following lipids were purchased from Avanti Polar Lipids (Alabaster, AL): 1-oleyl-2-palmitoyl-sn-glycero-3 phosphocholine (POPC) ...
-
bioRxiv - Biophysics 2020Quote: DMPC and Biotin-PE phospholipids were purchased from Avanti Polar Lipids Inc ...
-
bioRxiv - Bioengineering 2021Quote: ... 25 mg·ml-1 in chloroform) were sourced from Avanti Polar Lipids. Kdo2-Lipid A (di[3-deoxy-D-manno-octulosonyl]-lipid A (ammonium salt) ...
-
bioRxiv - Cell Biology 2021Quote: ... All lipids were purchased from Avanti Polar Lipids (Alabaster, AL, USA). Lipids ...
-
bioRxiv - Cell Biology 2022Quote: ... and NBD-PS (Cat.#810198) were purchased from Avanti Polar Lipids. NBD-glucose was purchased from Abcam (Cat ...
-
bioRxiv - Biochemistry 2022Quote: ... egg sphingomyelin (SM) and edelfosine were purchased from Avanti Polar lipids. The ATP8B1 C-terminal peptide RRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIVADGTAEYRRTGDS ...
-
bioRxiv - Immunology 2022Quote: ... 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) was from Avanti Polar Lipids. Triton X-100 was from MP Biomedicals ...
-
bioRxiv - Bioengineering 2022Quote: ... 1,2-dibehenoyl-sn-glycero-3-phosphocholine (DBPC) from Avanti Polar Lipids Inc ...
-
bioRxiv - Biophysics 2022Quote: ... and cholesterol (chol) were purchased from Avanti Polar Lipids (Alabaster, AL). All other chemicals were obtained from Sigma-Aldrich unless noted otherwise.
-
bioRxiv - Biophysics 2022Quote: ... sphingomyelin (SM) and cholesterol (chol)) were purchased from Avanti Polar Lipids. The Gb3 “mixture” (ceramide trihexoside from porcine brain ...
-
bioRxiv - Biochemistry 2022Quote: ... and phosphatidylethanolamine were purchased from Avanti Polar lipids (130601P, 840032P, 850725P) and prepared as previously described.6,7 Dade Innovin was purchased from Siemens and used as the TF source in purified and synthetic plasma systems ...
-
bioRxiv - Microbiology 2020Quote: ... and natural PI(4,5)P2 were purchased from Avanti Polar Lipids. His-tagged OCRL (50 nM ...
-
bioRxiv - Microbiology 2020Quote: ... All lipids were obtained from Avanti Polar Lipids (Alabaster, IL, USA).
-
bioRxiv - Biophysics 2020Quote: ... DPPC and cholesterol were purchased from Avanti Polar Lipids (Alabaster, AL), and used without further purification or characterization.
-
bioRxiv - Cancer Biology 2020Quote: Lipid internal standards (from Avanti Polar Lipids Inc., Alabaster, Alabama, USA)
-
bioRxiv - Developmental Biology 2022Quote: ... LPI 17:1 and LPS 17:1 from Avanti Polar Lipids. Free fatty acids were quantitated using d31-16:0 (Sigma-Aldrich ...
-
bioRxiv - Microbiology 2022Quote: ... All lipids were purchased from Avanti Polar Lipids (Alabaster, AL, USA).
-
bioRxiv - Biochemistry 2022Quote: The following lipids were purchased from Avanti Polar Lipids (Alabama, USA) as lyophilized powder ...
-
bioRxiv - Biophysics 2022Quote: ... and Biotin-PE were purchased from Avanti Polar Lipids (Alabaster, AL). Cholesterol and disialoganglioside (GD1a ...
-
bioRxiv - Biophysics 2020Quote: 18:1 (Δ9-cis) DOPC was purchased from Avanti Polar Lipids, Alabaster ...
-
bioRxiv - Synthetic Biology 2020Quote: ... and NBD-palmitoyl-CoA were obtained from Avanti Polar lipids (USA) in powdered form ...
-
bioRxiv - Biophysics 2020Quote: ... All these lipids were obtained from Avanti Polar Lipids (Alabaster, AL). Lipids were spread in 2 mM chloroform solution on the surface of a deionized water subphase (Milli-Q ...
-
bioRxiv - Biophysics 2021Quote: ... Cy5-PE and DC-Cholesterol) were purchased from Avanti Polar Lipids. anti- GABAA receptor γ2 IgG (cat# ...
-
bioRxiv - Cell Biology 2020Quote: ... Brain sphingomyelin (SM) and Cholesterol (CHL) purchased from Avanti Polar Lipids, (Alabaster ...
-
bioRxiv - Developmental Biology 2022Quote: ... Lipid standards were purchased from Avanti Polar Lipids (Alabaster, AL, USA) and Larodan Fine Chemicals (Malmö ...
-
bioRxiv - Biophysics 2022Quote: Powdered DMPC and ganglioside GM1 were purchased from Avanti Polar Lipids Inc ...
-
bioRxiv - Biophysics 2022Quote: ... and cholesterol (chol) were purchased from Avanti Polar Lipids (Alabaster, AL) as dry powders and used as supplied ...