Labshake search
Citations for Anaspec :
51 - 70 of 70 citations for Recombinant Human CD40 protein Fc tagged APC labeled since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Molecular Biology 2022Quote: ... Purified SIINFEKL peptide from ovalbumin protein (AnaSpec) was added to cells at 25 µg/ml for 4h ...
-
bioRxiv - Molecular Biology 2019Quote: Lyophilized Aβ1-42 and HiLyte Flour 488-labeled Aβ1-42 (FITC-Aβ) (Abcam, Cambridge, UK and Anaspec Fremont, California, USA respectively) were reconstituted in 1% NH4OH to 2 mg/ml concentration and was further diluted to 1 mg/ml in 1X PBS ...
-
bioRxiv - Cancer Biology 2023Quote: ... The kinase reaction was initiated by the addition of ATP (10 µM final) and fluorescein labeled Scrtide peptide (AnaSpec, Fremont, CA)(1 µM final) ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 1 μM JAG-1 protein (AnaSpec AS-61298, NC0243900) in a flat bottom 48-well plate (Corning 3548) ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2019Quote: ... MGP 1-64 (the first 64 amino acids of matrix Gla protein, Anaspec), 1 uM ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Neuroscience 2019Quote: ... Single cells were re-plated onto matrigel treated coverslips at low density in the presence of 10nM PACAP protein (AnaSpec) or 0.01% DMSO (Sigma) ...
-
bioRxiv - Bioengineering 2022Quote: ... ACE2-expressing HEK293T and HEK293T control cells were lysed and the activity of the ACE protein was assessed by the SensoLyte 390 ACE2 Activity Assay Kit (AnaSpec, USA) according to the manufacturer’s instructions ...