Labshake search
Citations for Anaspec :
51 - 100 of 183 citations for Rat EGF Latrophilin And Seven Transmembrane Domain Containing Protein 1 ELTD1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2024Quote: ... and 1-hydroxybenzotriazole hydrate (Anaspec), and finally 10 equiv ...
-
bioRxiv - Microbiology 2020Quote: The SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec, Fremont, CA) was used according to the manufacturer’s instruction to measure the activity of the enzyme in each supernatant fraction obtained from the osmotic shock procedure (Tris/MgSO4 wash ...
-
bioRxiv - Pathology 2022Quote: MMP-12 assay kit was purchased from AnaSpec (Fremont, CA). Frozen liver tissue (50-75 mg ...
-
bioRxiv - Neuroscience 2023Quote: ... The SensoLyte Red Glucocerebrosidase (GBA) Activity Assay Kit (AnaSpec, AS-72259) was used to determine enzyme activity in serum and whole tissue lysate samples ...
-
bioRxiv - Cell Biology 2020Quote: ... 1 μg/ml JAG1 peptide (Anaspec), 500 nM soluble recombinant NOTCH receptor inhibitor Delta Like Ligand 4 mutant (DLL4E12) ...
-
bioRxiv - Cancer Biology 2021Quote: ... αSMA 1:100 (AS-29553, Anaspec), CD31 1:100 (MEC13.1 ...
-
bioRxiv - Cell Biology 2023Quote: ... and Hoechst stain (1:2000, AnaSpec) at room temperature in the dark for 30 min ...
-
bioRxiv - Biochemistry 2023Quote: ... One mg of each protein was labeled with a 10-fold molar excess of TMR 5-iodoacetamide (5-TMRIA; Anaspec, San Jose, CA) per cysteine (from a stock concentration of 20 mM in dimethylformamide ...
-
bioRxiv - Immunology 2019Quote: ... Freshly harvested OT-1 splenocytes were stimulated with 10 nM SIINFEKL peptide (Anaspec, catalog AS-60193-1) in OT-1 culture medium supplemented with 100 U/ml mouse recombinant IL-2 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: ... and primary antibodies (rabbit anti-Iba1, 1:500 Wako #016-26461; rabbit anti-P2y12, 1:500 Anaspec #AS-55043A ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... we used a SensoLyte® HAT (p300) Assay Kit (Anaspec, Fremont, CA). Assay was conducted on a black walled 96-well petriplate (VWR ...
-
bioRxiv - Neuroscience 2021Quote: ... the sections were incubated for 30 minutes in ACSF with A580 MMP Substrate 1 (1 μg/ml, Anaspec) at RT ...
-
bioRxiv - Neuroscience 2023Quote: ... The following primary antibodies were used: 1) rabbit anti-pT217-tau at 1:200 (cat# AS-54968, Anaspec). The immunogen used KLH conjugated with synthetic peptides corresponding to human tau at phosphorylated threonine 217 ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12R (1:500; #55043AS, AnaSpec). After the incubation with the primaries ...
-
bioRxiv - Cell Biology 2021Quote: ... and 1mM Jagged-1 (AnaSpec AS-61298). Organoids were maintained at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... and P2RY12 (1:300, AnaSpec # AS-55043A). Sections were then washed thoroughly to remove excess antibodies and treated with fluorescently tagged secondary antibodies ...
-
bioRxiv - Biochemistry 2021Quote: ... and 1 mM 5-FAM-Lysine (Anaspec), prepared from a 20 mM stock in DMSO ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-P2RY12 (1:1000; AnaSpec, Fremont, CA), anti-GFAP (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... 0.5 µg LL-37 ml-1 (Anaspec), or both.
-
bioRxiv - Neuroscience 2023Quote: ... anti-P2ry12 (AS-55043A, AnaSpec, 1:1000), anti-Tmem119 (ab209064 ...
-
bioRxiv - Immunology 2021Quote: ... together with antigenic peptides (for Pmel-1, gp10025-33; for OT-1, OVA257-264) at 10μg/mouse (peptides were purchased from Anaspec). The control (CON ...
-
bioRxiv - Microbiology 2021Quote: ... pneumoniae cells were induced to competence by the addition of synthetic competence stimulatory peptide 1 (CSP-1; Anaspec, Inc.). Markerless deletions and replacements of target genes were constructed using the kanR-rpsL+ (Janus cassette ...
-
bioRxiv - Immunology 2022Quote: Elastin cleavage was examined using a SensoLyte® Green Elastase Assay Kit (AnaSpec). Porcine elastase (AnaSpec ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2ry12 (1:500, Anaspec, AS-55043A); goat anti-Pdgfr-α (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12 (1:400, Anaspec, AS-55043A), rabbit anti-Iba1 (1:500 ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Aβ(1-40) was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (Anaspec, AS-55043A, 1:200). Secondary antibodies used were Alexa-conjugated goat antibodies (Invitrogen ...
-
bioRxiv - Neuroscience 2020Quote: ... and anti GFP (chicken, Anaspec/Tebu; 1/1000). Appropriate secondary antibodies were used (goat anti-mouse Alexa 546 Vector ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit pAb anti-P2RY12 (Anaspec, 55043A; 1:2000) and guinea pig pAb anti-VGluT2 (Millipore ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (1:500, Anaspec; AS-55043A), rat anti-CD68 (1:500 ...
-
bioRxiv - Developmental Biology 2023Quote: ... rabbit anti-Shha (AnaSpec,, AS-55574, 1:20), rabbit anti-human PROX1 (ReliaTech ...
-
bioRxiv - Neuroscience 2023Quote: Commercial Aβ 1-42 monomer (Anaspec, AS-20276) was prepared at 2 μM in saline sodium phosphate EDTA (SSPE ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... Gelatinase activity was measured using the SensolyteGeneric MMP colorimetric assay kit (Anaspec, Fremont, CA). Samples were run in duplicate and end-point enzymatic activity was analyzed using a glutathione reference standard.
-
bioRxiv - Microbiology 2021Quote: ... Recombinant PfQC activities were determined using SensoLyte green glutaminyl cyclase activity assay kit (Anaspec). Briefly ...
-
bioRxiv - Immunology 2022Quote: Generic MMP function was determined using a Generic MMP Activity Kit (AnaSpec, AS-72202) as per the kit’s instructions ...
-
bioRxiv - Immunology 2021Quote: ... slides were incubated in blocking at RT for 1 h before overnight incubation at 4°C with the primary rabbit anti-P2Y12 receptor antibody (1:200, AnaSpec #AS-55043A) and labelling for 1 hour with the secondary antibody AF488 goat anti-rabbit ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cells were collected in media on 1mL Eppendorf tubes before being grown in matrigel supplemented with Jagged-1 (Anaspec, 1 µM) and cultured in advanced DMEM/F12 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2023Quote: ... + 1xPBS + .03% Triton + primary antibodies (chicken anti-Iba1: 1:1000, Synaptic Systems 234 009; rabbit anti-P2RY12: 1:500, Anaspec AS-55043A). After primary antibody incubation ...
-
bioRxiv - Developmental Biology 2021Quote: ... rabbit anti-BMP2b-Zebrafish (1:50, Anaspec, AS-55708), mouse anti-NeuroD1 (1:500 ...