Labshake search
Citations for Anaspec :
51 - 100 of 152 citations for Mouse Anti Dengue Virus Envelope Protein Serotype 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Neuroscience 2021Quote: We added 1 mg Aβ peptide (1-42) (Anaspec, CA, USA) into a microtube containing 270 μL of 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Neuroscience 2019Quote: ... Single cells were re-plated onto matrigel treated coverslips at low density in the presence of 10nM PACAP protein (AnaSpec) or 0.01% DMSO (Sigma) ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Bioengineering 2022Quote: ... ACE2-expressing HEK293T and HEK293T control cells were lysed and the activity of the ACE protein was assessed by the SensoLyte 390 ACE2 Activity Assay Kit (AnaSpec, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2019Quote: ... or 100 μg/ml 1:1 ratio of FITC conjugated collagen (Anaspec AS-85111) and non-labelled collagen (Corning 354236 ...
-
bioRxiv - Biochemistry 2024Quote: ... and 1-hydroxybenzotriazole hydrate (Anaspec), and finally 10 equiv ...
-
bioRxiv - Cell Biology 2020Quote: ... 1 μg/ml JAG1 peptide (Anaspec), 500 nM soluble recombinant NOTCH receptor inhibitor Delta Like Ligand 4 mutant (DLL4E12) ...
-
bioRxiv - Cancer Biology 2021Quote: ... αSMA 1:100 (AS-29553, Anaspec), CD31 1:100 (MEC13.1 ...
-
bioRxiv - Cell Biology 2023Quote: ... and Hoechst stain (1:2000, AnaSpec) at room temperature in the dark for 30 min ...
-
bioRxiv - Biochemistry 2023Quote: ... One mg of each protein was labeled with a 10-fold molar excess of TMR 5-iodoacetamide (5-TMRIA; Anaspec, San Jose, CA) per cysteine (from a stock concentration of 20 mM in dimethylformamide ...
-
bioRxiv - Immunology 2019Quote: ... Freshly harvested OT-1 splenocytes were stimulated with 10 nM SIINFEKL peptide (Anaspec, catalog AS-60193-1) in OT-1 culture medium supplemented with 100 U/ml mouse recombinant IL-2 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2021Quote: ... the sections were incubated for 30 minutes in ACSF with A580 MMP Substrate 1 (1 μg/ml, Anaspec) at RT ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Cell Biology 2021Quote: ... and 1mM Jagged-1 (AnaSpec AS-61298). Organoids were maintained at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... and P2RY12 (1:300, AnaSpec # AS-55043A). Sections were then washed thoroughly to remove excess antibodies and treated with fluorescently tagged secondary antibodies ...
-
bioRxiv - Biochemistry 2021Quote: ... and 1 mM 5-FAM-Lysine (Anaspec), prepared from a 20 mM stock in DMSO ...
-
bioRxiv - Microbiology 2023Quote: ... 0.5 µg LL-37 ml-1 (Anaspec), or both.
-
bioRxiv - Microbiology 2021Quote: ... pneumoniae cells were induced to competence by the addition of synthetic competence stimulatory peptide 1 (CSP-1; Anaspec, Inc.). Markerless deletions and replacements of target genes were constructed using the kanR-rpsL+ (Janus cassette ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Aβ(1-40) was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2023Quote: Commercial Aβ 1-42 monomer (Anaspec, AS-20276) was prepared at 2 μM in saline sodium phosphate EDTA (SSPE ...
-
bioRxiv - Molecular Biology 2019Quote: Primary antibodies used for immunoblotting were as follows: anti-IKAP (Anaspec, cat# 54494), anti-acetylated α-tubulin (Sigma ...
-
bioRxiv - Cell Biology 2023Quote: ... the sections were reacted with polyclonal anti-GFP antibody (AnaSpec, Fremont, CA, US) diluted 1:500 in 3% (w/v ...
-
bioRxiv - Plant Biology 2023Quote: ... the sections were reacted with polyclonal anti-GFP antibody (AnaSpec, Fremont, CA, US) diluted 1:500 in 3% (w/v ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cells were collected in media on 1mL Eppendorf tubes before being grown in matrigel supplemented with Jagged-1 (Anaspec, 1 µM) and cultured in advanced DMEM/F12 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: ... 20 µM cdk5 substrate peptide (PKTPKKAKKL, Anaspec #60026-1). The reaction was allowed to proceed for 25 minutes ...
-
bioRxiv - Biochemistry 2023Quote: ... followed by HRP-conjugated secondary antibody (Anaspec, 1:2000). Antibodies were dissolved in 1X TBS with 0.05% Tween-20 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Cell Biology 2024Quote: ... ISCs (2,000 cells) and Paneth cells (2000 cells) were then seeded into 30 μl Matrigel containing 1 μM Jagged-1 (AnaSpec, San Jose, CA) and 10 μM Y-27632 ...
-
bioRxiv - Neuroscience 2020Quote: ... rabbit anti-Rapgef2 (NNLE-2, custom-made by Anaspec, see ref. (Jiang et al., 2017). Confocal images were obtained on a Zeiss LSM 510 confocal microscope at the National Institute of Neurological Disorders and Stroke Light Imaging Facility ...
-
bioRxiv - Neuroscience 2021Quote: ... with a total 200μg MOG35-55 (AnaSpec, AS-60130-1) per mouse was injected subcutaneously into all 4 flanks ...
-
bioRxiv - Cell Biology 2022Quote: ... and nuclei stained using Hoescht 33342 (1:1000, AnaSpec Inc.). Slides were mounted using Fluoromount-G (SouthernBiotech ...
-
bioRxiv - Immunology 2021Quote: ... cells were pulsed with 1 ng/ml SIINFEKL peptide (AnaSpec) for 30 min ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Neuroscience 2022Quote: ... and rabbit anti-Rapgef2 (NNLE-2, custom-made by Anaspec, see ref. (Jiang et al., 2017)) ...