Labshake search
Citations for Anaspec :
1 - 50 of 184 citations for Human Tyrosinase Related Protein 1 TYRP1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... Total anti-MOG IgG was quantified by using SensoLyte Anti-Mouse MOG(1–125) IgG Quantitative ELISA Kit (Anaspec).
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 1 μM JAG-1 protein (AnaSpec AS-61298, NC0243900) in a flat bottom 48-well plate (Corning 3548) ...
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Biophysics 2020Quote: ... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
bioRxiv - Neuroscience 2020Quote: Human Aβ42 (AnaSpec) or human biotin-beta-Amyloid (1-42 ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Biochemistry 2019Quote: ... MGP 1-64 (the first 64 amino acids of matrix Gla protein, Anaspec), 1 uM ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: ... One mg of lyophilized human Aβ42 (Anaspec) or scrambled Aβ42 (Anaspec ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Bioengineering 2022Quote: ... ACE2-expressing HEK293T and HEK293T control cells were lysed and the activity of the ACE protein was assessed by the SensoLyte 390 ACE2 Activity Assay Kit (AnaSpec, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Molecular Biology 2022Quote: ... Purified SIINFEKL peptide from ovalbumin protein (AnaSpec) was added to cells at 25 µg/ml for 4h ...
-
bioRxiv - Biochemistry 2020Quote: Stock solutions of HiLyte™ Fluor 488- labeled Human Aβ42 (Aβ, 0.1 mg; AnaSpec, USA) were prepared by dissolving the lyophilized peptide (1% NH4OH ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ThT assays were performed using the SensoLyte ® Thioflavin T β-Amyloid (1 – 42) Aggregation Kit (Anaspec, Cat no: AS-72214) with slight modifications to the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Microbiology 2023Quote: ... 1 μM Jagged 1 (Anaspec), 10 nM Y-27632 (Cayman Chemical Company) ...
-
bioRxiv - Immunology 2019Quote: ... 10□1 of 1□M SIINFEKL (AnaSpec) or SIIQFEKL (Q4 ...
-
bioRxiv - Developmental Biology 2022Quote: ... 1 μM Jagged-1 (Anaspec, AS-61298), 2.5 μM Thiazovivin (Selleckchem ...
-
bioRxiv - Biochemistry 2021Quote: ... a HABA biotin quantification kit (AnaSpec) was used to measure the biotin concentrations of each solution ...
-
bioRxiv - Molecular Biology 2021Quote: ... Phagocytosis assays were done by incubating BV2 cells with 100 µM HiLyte™ Fluor 488-labeled human Aβ1-42 (Anaspec #AS-60479-01) for three hours in the presence or absence of the hybrid protein at 37°C for Aβ uptake and at 4°C for surface binding assay following Prasad and Rao (2018).
-
bioRxiv - Neuroscience 2022Quote: ... β-amyloid 1-42 (Aβ42, 1 μM, Anaspec, Fremont CA)31 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 1 μM Jagged-1 (AnaSpec, Fremont, CA, USA) in Advanced DMEM/F12 (Thermo Fisher Scientific) ...
-
bioRxiv - Bioengineering 2023Quote: ... MMP-13 production was measured using an enzyme-specific fluorescence substrate kit (SensoLyte 520 MMP-13 Assay Kit; AnaSpec), according to the manufacturer’s instructions.
-
bioRxiv - Cell Biology 2019Quote: ... 1 mg ml−1 of fluoresceinated gelatin (Gelatin-FITC,Anaspec) in PBS was injected (4-5 ng ...
-
bioRxiv - Bioengineering 2023Quote: ... was determined via analysis of spent culture medium (n = 5/group/time) using a commercially available FRET-based generic MMP activity kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric; Anaspec). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Genetics 2020Quote: ... using the SensoLyte Malachite Green Assay kit (AnaSpec) in assay buffer (MgCl2 2 mmol/L ...
-
bioRxiv - Neuroscience 2021Quote: We added 1 mg Aβ peptide (1-42) (Anaspec, CA, USA) into a microtube containing 270 μL of 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP ...