Labshake search
Citations for Anaspec :
1 - 50 of 65 citations for Human Apelin 13 AP13 CLIA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... MMP-13 production was measured using an enzyme-specific fluorescence substrate kit (SensoLyte 520 MMP-13 Assay Kit; AnaSpec), according to the manufacturer’s instructions.
-
bioRxiv - Biophysics 2020Quote: ... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
bioRxiv - Neuroscience 2020Quote: Human Aβ42 (AnaSpec) or human biotin-beta-Amyloid (1-42 ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2023Quote: ... 5 mM of one of the glycopeptides (Muc5AC-3, Muc5AC-13, Muc5AC-3,13, Cst1.4, and Srs13.2 (Anaspec, Fremont, CA), 5 mM UDP-2-(acetylamino)-4-F-D-galactosamine disodium salt (UDP-GalNAc-F) ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: ... One mg of lyophilized human Aβ42 (Anaspec) or scrambled Aβ42 (Anaspec ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Biochemistry 2020Quote: Stock solutions of HiLyte™ Fluor 488- labeled Human Aβ42 (Aβ, 0.1 mg; AnaSpec, USA) were prepared by dissolving the lyophilized peptide (1% NH4OH ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Biochemistry 2021Quote: ... a HABA biotin quantification kit (AnaSpec) was used to measure the biotin concentrations of each solution ...
-
bioRxiv - Molecular Biology 2021Quote: ... Phagocytosis assays were done by incubating BV2 cells with 100 µM HiLyte™ Fluor 488-labeled human Aβ1-42 (Anaspec #AS-60479-01) for three hours in the presence or absence of the hybrid protein at 37°C for Aβ uptake and at 4°C for surface binding assay following Prasad and Rao (2018).
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Bioengineering 2023Quote: ... was determined via analysis of spent culture medium (n = 5/group/time) using a commercially available FRET-based generic MMP activity kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric; Anaspec). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Genetics 2020Quote: ... using the SensoLyte Malachite Green Assay kit (AnaSpec) in assay buffer (MgCl2 2 mmol/L ...
-
bioRxiv - Cell Biology 2023Quote: Analyses of MMP-2 activity were performed by a fluorescence assay kit (SensoLyte® 520 MMP-2 kit, AnaSpec, San Jose, USA). The fluorescence of the substrate cleavage product was determined at excitation/emission = 490 nm/520 nm with a Perkin-Elmer spectrofluorometer [21,22].
-
bioRxiv - Bioengineering 2024Quote: ... was determined via analysis of spent culture medium (n= 8-10/group) using a commercially available FRET-based generic MMP cleavage kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric, Anaspec, Fremont, CA). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Microbiology 2023Quote: ... Malachite green reagent (SensoLyte MG Phosphate Assay Kit [AnaSpec]) was added to each reaction and incubated for 30 min before measuring absorbance at 660 nm ...
-
bioRxiv - Microbiology 2020Quote: The SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec, Fremont, CA) was used according to the manufacturer’s instruction to measure the activity of the enzyme in each supernatant fraction obtained from the osmotic shock procedure (Tris/MgSO4 wash ...
-
bioRxiv - Pathology 2022Quote: MMP-12 assay kit was purchased from AnaSpec (Fremont, CA). Frozen liver tissue (50-75 mg ...
-
bioRxiv - Neuroscience 2023Quote: ... The SensoLyte Red Glucocerebrosidase (GBA) Activity Assay Kit (AnaSpec, AS-72259) was used to determine enzyme activity in serum and whole tissue lysate samples ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... we used a SensoLyte® HAT (p300) Assay Kit (Anaspec, Fremont, CA). Assay was conducted on a black walled 96-well petriplate (VWR ...
-
bioRxiv - Immunology 2022Quote: Elastin cleavage was examined using a SensoLyte® Green Elastase Assay Kit (AnaSpec). Porcine elastase (AnaSpec ...
-
bioRxiv - Neuroscience 2019Quote: ... Gelatinase activity was measured using the SensolyteGeneric MMP colorimetric assay kit (Anaspec, Fremont, CA). Samples were run in duplicate and end-point enzymatic activity was analyzed using a glutathione reference standard.
-
bioRxiv - Microbiology 2021Quote: ... Recombinant PfQC activities were determined using SensoLyte green glutaminyl cyclase activity assay kit (Anaspec). Briefly ...
-
bioRxiv - Immunology 2022Quote: Generic MMP function was determined using a Generic MMP Activity Kit (AnaSpec, AS-72202) as per the kit’s instructions ...
-
bioRxiv - Bioengineering 2020Quote: ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to the manufacturer’s protocol ...
-
bioRxiv - Genetics 2019Quote: ... separate cells were harvested and analyzed using the SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec) according to manufacturer’s instructions ...
-
bioRxiv - Immunology 2023Quote: ... Tetanus Toxoid (TT) was labeled with APC or PE using an AnaTag labeling kit (Anaspec) according to the manufacturer’s protocol ...
-
bioRxiv - Microbiology 2023Quote: ... Cathepsin B activity in cytosolic fractions was measured using the SensoLyte 520 Cathepsin B Assay Kit (AnaSpec) according to the manufacturer’s instructions ...