Labshake search
Citations for Anaspec :
1 - 50 of 108 citations for Human Amyloid Beta 42 Abeta42 CLIA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2022Quote: ... β-amyloid 1-42 (Aβ42, 1 μM, Anaspec, Fremont CA)31 ...
-
bioRxiv - Cell Biology 2019Quote: Fibril/aggregation formation of 15 μM β-amyloid (1-42) (Anaspec) or purified 20 μM α-synuclein A53T ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Cancer Biology 2022Quote: ... green (HiLyte Fluor 488) florescent β-amyloid (1 - 42) peptide (Anaspec, Fremont, CA) was used ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Physiology 2023Quote: 0.1 mg of lyophilized HiLyte Fluor 488-labeled amyloid-β1-42 (Anaspec AS-60479-01) was dissolved in 50 µL of 1% NH4OH and diluted to 0.5 mg/mL with 1xPBS before aliquoting for storage at −20°C until further use ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ThT assays were performed using the SensoLyte ® Thioflavin T β-Amyloid (1 – 42) Aggregation Kit (Anaspec, Cat no: AS-72214) with slight modifications to the manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: ... β-Amyloid (Anaspec-AS-60479).
-
bioRxiv - Neuroscience 2021Quote: ... Lyophilized Hilyte488-tagged amyloid-β42 (Aβ42-Hilyte488, Anaspec) was diluted to 100μM and sonicated for 10min ...
-
bioRxiv - Neuroscience 2021Quote: β-amyloid peptide was purchased from Anaspec (AS-23523-05). The β-amyloid peptide was dissolved clearly in Hexafluoro-2-propanol (HFIP) ...
-
bioRxiv - Neuroscience 2022Quote: ... Amyloid-β42-HiLyte Fluor 488 was obtained from AnaSpec. Uptake for immunostaining experiments was performed in 24-well plates containing glass coverslips ...
-
bioRxiv - Neuroscience 2021Quote: ... synthetic Aβ1–42 (AnaSpec) was dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2021Quote: ... or FAM-Aβ1-42 (Anaspec) was dissolved in hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: The ThT fluorescence assay was performed using the SensoLyte Thioflavin T β-Amyloid Aggregation Kit (ANASPEC, Fremont, CA, USA). Aβ and ThT solutions at final concentrations of 50 μM and 200 μM ...
-
bioRxiv - Molecular Biology 2021Quote: ... Aβ1-42 peptides (Anaspec and Abcam) were prepared following standard protocols [65] as dried HFIP films ...
-
bioRxiv - Neuroscience 2022Quote: ... synthetic Aβ1-42 (AnaSpec, Catalog # AS20276) was dissolved in 1,1,1,3,3,3-hexafluoro 2-propanol (Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2022Quote: ... the Aβ1-42 peptide film (Anaspec) was re-suspended in 2 µl DMSO (Sigma-Aldrich) ...
-
bioRxiv - Molecular Biology 2021Quote: ... synthetic Aβ1-42 (Anaspec AS-60479-01) was prepared by resuspending the lyophilized protein in hexafluoroisopropanol (HFIP MPBio #151245) ...
-
bioRxiv - Biochemistry 2020Quote: ... insulin and α-lactalbumin were obtained from Sigma Aldrich and Aβ1-42 was purchased from AnaSpec. κ-casein was reduced and carboxymethylated (RCM ...
-
bioRxiv - Neuroscience 2020Quote: Solutions of Aβ1-42 (American Peptide; Anaspec) were prepared from aqueous stock solutions ...
-
bioRxiv - Neuroscience 2023Quote: ... Aβ3(pE)-42 (Anaspec, Cat.: #AS-29907), and FAM-Aβ3(pE)-42 (Eurogentec ...
-
bioRxiv - Neuroscience 2021Quote: ... HiLyte™ Fluor 488-labeled amyloid β peptide 25-35 (Anaspec, AS-633308) was prepared according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2021Quote: ... Phagocytosis assays were done by incubating BV2 cells with 100 µM HiLyte™ Fluor 488-labeled human Aβ1-42 (Anaspec #AS-60479-01) for three hours in the presence or absence of the hybrid protein at 37°C for Aβ uptake and at 4°C for surface binding assay following Prasad and Rao (2018).
-
bioRxiv - Neuroscience 2022Quote: ... fluorescent Aβ1-42-hilyte555 (Anaspec AS-60480-01), scrambled Aβ1-42 (Aβscr ...
-
bioRxiv - Neuroscience 2023Quote: Commercial Aβ 1-42 monomer (Anaspec, AS-20276) was prepared at 2 μM in saline sodium phosphate EDTA (SSPE ...
-
bioRxiv - Molecular Biology 2019Quote: Lyophilized Aβ1-42 and HiLyte Flour 488-labeled Aβ1-42 (FITC-Aβ) (Abcam, Cambridge, UK and Anaspec Fremont, California, USA respectively) were reconstituted in 1% NH4OH to 2 mg/ml concentration and was further diluted to 1 mg/ml in 1X PBS ...