Labshake search
Citations for Anaspec :
51 - 100 of 171 citations for Cyclic AMP Direct Chemiluminescent ELISA Kit 1 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: ... anti-P2ry12 (AS-55043A, AnaSpec, 1:1000), anti-Tmem119 (ab209064 ...
-
bioRxiv - Microbiology 2023Quote: ... 0.5 µg LL-37 ml-1 (Anaspec), or both.
-
bioRxiv - Immunology 2021Quote: ... together with antigenic peptides (for Pmel-1, gp10025-33; for OT-1, OVA257-264) at 10μg/mouse (peptides were purchased from Anaspec). The control (CON ...
-
bioRxiv - Microbiology 2021Quote: ... pneumoniae cells were induced to competence by the addition of synthetic competence stimulatory peptide 1 (CSP-1; Anaspec, Inc.). Markerless deletions and replacements of target genes were constructed using the kanR-rpsL+ (Janus cassette ...
-
bioRxiv - Immunology 2022Quote: Elastin cleavage was examined using a SensoLyte® Green Elastase Assay Kit (AnaSpec). Porcine elastase (AnaSpec ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2ry12 (1:500, Anaspec, AS-55043A); goat anti-Pdgfr-α (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12 (1:400, Anaspec, AS-55043A), rabbit anti-Iba1 (1:500 ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Aβ(1-40) was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (Anaspec, AS-55043A, 1:200). Secondary antibodies used were Alexa-conjugated goat antibodies (Invitrogen ...
-
bioRxiv - Neuroscience 2020Quote: ... and anti GFP (chicken, Anaspec/Tebu; 1/1000). Appropriate secondary antibodies were used (goat anti-mouse Alexa 546 Vector ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit pAb anti-P2RY12 (Anaspec, 55043A; 1:2000) and guinea pig pAb anti-VGluT2 (Millipore ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (1:500, Anaspec; AS-55043A), rat anti-CD68 (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: Commercial Aβ 1-42 monomer (Anaspec, AS-20276) was prepared at 2 μM in saline sodium phosphate EDTA (SSPE ...
-
bioRxiv - Developmental Biology 2023Quote: ... rabbit anti-Shha (AnaSpec,, AS-55574, 1:20), rabbit anti-human PROX1 (ReliaTech ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... Gelatinase activity was measured using the SensolyteGeneric MMP colorimetric assay kit (Anaspec, Fremont, CA). Samples were run in duplicate and end-point enzymatic activity was analyzed using a glutathione reference standard.
-
bioRxiv - Microbiology 2021Quote: ... Recombinant PfQC activities were determined using SensoLyte green glutaminyl cyclase activity assay kit (Anaspec). Briefly ...
-
bioRxiv - Immunology 2022Quote: Generic MMP function was determined using a Generic MMP Activity Kit (AnaSpec, AS-72202) as per the kit’s instructions ...
-
bioRxiv - Immunology 2021Quote: ... slides were incubated in blocking at RT for 1 h before overnight incubation at 4°C with the primary rabbit anti-P2Y12 receptor antibody (1:200, AnaSpec #AS-55043A) and labelling for 1 hour with the secondary antibody AF488 goat anti-rabbit ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cells were collected in media on 1mL Eppendorf tubes before being grown in matrigel supplemented with Jagged-1 (Anaspec, 1 µM) and cultured in advanced DMEM/F12 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2023Quote: ... + 1xPBS + .03% Triton + primary antibodies (chicken anti-Iba1: 1:1000, Synaptic Systems 234 009; rabbit anti-P2RY12: 1:500, Anaspec AS-55043A). After primary antibody incubation ...
-
bioRxiv - Developmental Biology 2021Quote: ... rabbit anti-BMP2b-Zebrafish (1:50, Anaspec, AS-55708), mouse anti-NeuroD1 (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... 20 µM cdk5 substrate peptide (PKTPKKAKKL, Anaspec #60026-1). The reaction was allowed to proceed for 25 minutes ...
-
bioRxiv - Neuroscience 2021Quote: ... and rabbit anti-P2Y12 (AnaSpec, AS-55043A, 1:1000) were used for immunostaining ...
-
bioRxiv - Immunology 2022Quote: ... anti-P2Y12 (1: 500, AnaSpec, SQ-ANAB-78839, discontinued). Appropriate secondary antibodies were purchased from Leica or Vectorlab ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-P2RY12 (1:300, catalog no. 55043A, AnaSpec), mouse anti-SMI32 (1:1,000 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-P2RY12 (1:300, catalog no. 55043A, AnaSpec); rabbit anti-GAL3 (1:1,000 ...
-
bioRxiv - Biochemistry 2023Quote: ... followed by HRP-conjugated secondary antibody (Anaspec, 1:2000). Antibodies were dissolved in 1X TBS with 0.05% Tween-20 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Bioengineering 2020Quote: ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to the manufacturer’s protocol ...
-
bioRxiv - Genetics 2019Quote: ... separate cells were harvested and analyzed using the SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec) according to manufacturer’s instructions ...
-
bioRxiv - Immunology 2023Quote: ... Tetanus Toxoid (TT) was labeled with APC or PE using an AnaTag labeling kit (Anaspec) according to the manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by incubation overnight at 4°C with rat anti-Mer (1:1000, eBioscience, cat# 14-5751-82) and rabbit anti-P2RY12 (1:2000, AnaSpec, cat# AS-55043A) in 2% NGS and 2% NDS in PBS-T ...
-
bioRxiv - Cell Biology 2024Quote: ... ISCs (2,000 cells) and Paneth cells (2000 cells) were then seeded into 30 μl Matrigel containing 1 μM Jagged-1 (AnaSpec, San Jose, CA) and 10 μM Y-27632 ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2021Quote: ... with a total 200μg MOG35-55 (AnaSpec, AS-60130-1) per mouse was injected subcutaneously into all 4 flanks ...
-
bioRxiv - Cell Biology 2022Quote: ... and nuclei stained using Hoescht 33342 (1:1000, AnaSpec Inc.). Slides were mounted using Fluoromount-G (SouthernBiotech ...
-
bioRxiv - Immunology 2021Quote: ... cells were pulsed with 1 ng/ml SIINFEKL peptide (AnaSpec) for 30 min ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Microbiology 2023Quote: ... Cathepsin B activity in cytosolic fractions was measured using the SensoLyte 520 Cathepsin B Assay Kit (AnaSpec) according to the manufacturer’s instructions ...