Labshake search
Citations for Anaspec :
51 - 100 of 168 citations for 7 Benzylamino 4 nitrobenz 2 oxa 1 3 diazole since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2019Quote: ... or 100 μg/ml 1:1 ratio of FITC conjugated collagen (Anaspec AS-85111) and non-labelled collagen (Corning 354236 ...
-
bioRxiv - Immunology 2020Quote: ... before addition of 1 mL of vesiculation buffer (GPMV buffer plus 25 mM PFA (paraformaldehyde, Electron Microscopy Services) and 2 mM DTT (1,4-dithiothreitol, Anaspec). Cells were incubated for 1 hour at 37°C and GPMVs were collected by removing supernatant from cells.
-
bioRxiv - Biochemistry 2024Quote: ... and 1-hydroxybenzotriazole hydrate (Anaspec), and finally 10 equiv ...
-
bioRxiv - Cell Biology 2020Quote: ... 1 μg/ml JAG1 peptide (Anaspec), 500 nM soluble recombinant NOTCH receptor inhibitor Delta Like Ligand 4 mutant (DLL4E12) ...
-
bioRxiv - Cancer Biology 2021Quote: ... αSMA 1:100 (AS-29553, Anaspec), CD31 1:100 (MEC13.1 ...
-
bioRxiv - Cell Biology 2023Quote: ... and Hoechst stain (1:2000, AnaSpec) at room temperature in the dark for 30 min ...
-
bioRxiv - Immunology 2019Quote: ... Freshly harvested OT-1 splenocytes were stimulated with 10 nM SIINFEKL peptide (Anaspec, catalog AS-60193-1) in OT-1 culture medium supplemented with 100 U/ml mouse recombinant IL-2 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: ... and primary antibodies (rabbit anti-Iba1, 1:500 Wako #016-26461; rabbit anti-P2y12, 1:500 Anaspec #AS-55043A ...
-
bioRxiv - Neuroscience 2021Quote: ... the sections were incubated for 30 minutes in ACSF with A580 MMP Substrate 1 (1 μg/ml, Anaspec) at RT ...
-
bioRxiv - Neuroscience 2023Quote: ... The following primary antibodies were used: 1) rabbit anti-pT217-tau at 1:200 (cat# AS-54968, Anaspec). The immunogen used KLH conjugated with synthetic peptides corresponding to human tau at phosphorylated threonine 217 ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12R (1:500; #55043AS, AnaSpec). After the incubation with the primaries ...
-
bioRxiv - Cell Biology 2021Quote: ... and 1mM Jagged-1 (AnaSpec AS-61298). Organoids were maintained at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... and P2RY12 (1:300, AnaSpec # AS-55043A). Sections were then washed thoroughly to remove excess antibodies and treated with fluorescently tagged secondary antibodies ...
-
bioRxiv - Biochemistry 2021Quote: ... and 1 mM 5-FAM-Lysine (Anaspec), prepared from a 20 mM stock in DMSO ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-P2RY12 (1:1000; AnaSpec, Fremont, CA), anti-GFAP (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... 0.5 µg LL-37 ml-1 (Anaspec), or both.
-
bioRxiv - Neuroscience 2023Quote: ... anti-P2ry12 (AS-55043A, AnaSpec, 1:1000), anti-Tmem119 (ab209064 ...
-
bioRxiv - Immunology 2021Quote: ... together with antigenic peptides (for Pmel-1, gp10025-33; for OT-1, OVA257-264) at 10μg/mouse (peptides were purchased from Anaspec). The control (CON ...
-
bioRxiv - Microbiology 2021Quote: ... pneumoniae cells were induced to competence by the addition of synthetic competence stimulatory peptide 1 (CSP-1; Anaspec, Inc.). Markerless deletions and replacements of target genes were constructed using the kanR-rpsL+ (Janus cassette ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2ry12 (1:500, Anaspec, AS-55043A); goat anti-Pdgfr-α (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12 (1:400, Anaspec, AS-55043A), rabbit anti-Iba1 (1:500 ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Aβ(1-40) was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (Anaspec, AS-55043A, 1:200). Secondary antibodies used were Alexa-conjugated goat antibodies (Invitrogen ...
-
bioRxiv - Neuroscience 2020Quote: ... and anti GFP (chicken, Anaspec/Tebu; 1/1000). Appropriate secondary antibodies were used (goat anti-mouse Alexa 546 Vector ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit pAb anti-P2RY12 (Anaspec, 55043A; 1:2000) and guinea pig pAb anti-VGluT2 (Millipore ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (1:500, Anaspec; AS-55043A), rat anti-CD68 (1:500 ...
-
bioRxiv - Developmental Biology 2023Quote: ... rabbit anti-Shha (AnaSpec,, AS-55574, 1:20), rabbit anti-human PROX1 (ReliaTech ...
-
bioRxiv - Neuroscience 2023Quote: Commercial Aβ 1-42 monomer (Anaspec, AS-20276) was prepared at 2 μM in saline sodium phosphate EDTA (SSPE ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cells were collected in media on 1mL Eppendorf tubes before being grown in matrigel supplemented with Jagged-1 (Anaspec, 1 µM) and cultured in advanced DMEM/F12 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2023Quote: ... + 1xPBS + .03% Triton + primary antibodies (chicken anti-Iba1: 1:1000, Synaptic Systems 234 009; rabbit anti-P2RY12: 1:500, Anaspec AS-55043A). After primary antibody incubation ...
-
bioRxiv - Developmental Biology 2021Quote: ... rabbit anti-BMP2b-Zebrafish (1:50, Anaspec, AS-55708), mouse anti-NeuroD1 (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... 20 µM cdk5 substrate peptide (PKTPKKAKKL, Anaspec #60026-1). The reaction was allowed to proceed for 25 minutes ...
-
bioRxiv - Neuroscience 2021Quote: ... and rabbit anti-P2Y12 (AnaSpec, AS-55043A, 1:1000) were used for immunostaining ...
-
bioRxiv - Immunology 2022Quote: ... anti-P2Y12 (1: 500, AnaSpec, SQ-ANAB-78839, discontinued). Appropriate secondary antibodies were purchased from Leica or Vectorlab ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-P2RY12 (1:300, catalog no. 55043A, AnaSpec), mouse anti-SMI32 (1:1,000 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-P2RY12 (1:300, catalog no. 55043A, AnaSpec); rabbit anti-GAL3 (1:1,000 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...