Labshake search
Citations for Anaspec :
101 - 150 of 190 citations for 6H Dipyrido 3 2 b 2' 3' e 1 4 diazepin 6 one 11 ethyl 5 11 dihydro 8 2 hydroxyethyl 5 methyl since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2ry12 (1:500, Anaspec, AS-55043A); goat anti-Pdgfr-α (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12 (1:400, Anaspec, AS-55043A), rabbit anti-Iba1 (1:500 ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Aβ(1-40) was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (Anaspec, AS-55043A, 1:200). Secondary antibodies used were Alexa-conjugated goat antibodies (Invitrogen ...
-
bioRxiv - Neuroscience 2020Quote: ... and anti GFP (chicken, Anaspec/Tebu; 1/1000). Appropriate secondary antibodies were used (goat anti-mouse Alexa 546 Vector ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit pAb anti-P2RY12 (Anaspec, 55043A; 1:2000) and guinea pig pAb anti-VGluT2 (Millipore ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2Y12 (1:500, Anaspec; AS-55043A), rat anti-CD68 (1:500 ...
-
bioRxiv - Developmental Biology 2023Quote: ... rabbit anti-Shha (AnaSpec,, AS-55574, 1:20), rabbit anti-human PROX1 (ReliaTech ...
-
bioRxiv - Neuroscience 2023Quote: Commercial Aβ 1-42 monomer (Anaspec, AS-20276) was prepared at 2 μM in saline sodium phosphate EDTA (SSPE ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Bioengineering 2019Quote: ... HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ (1-42) (FAM Scr Aβ) were purchased from AnaSpec (Fremont, CA). All other unspecified reagents were purchased from Sigma Aldrich (St ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cells were collected in media on 1mL Eppendorf tubes before being grown in matrigel supplemented with Jagged-1 (Anaspec, 1 µM) and cultured in advanced DMEM/F12 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2023Quote: ... + 1xPBS + .03% Triton + primary antibodies (chicken anti-Iba1: 1:1000, Synaptic Systems 234 009; rabbit anti-P2RY12: 1:500, Anaspec AS-55043A). After primary antibody incubation ...
-
bioRxiv - Developmental Biology 2021Quote: ... rabbit anti-BMP2b-Zebrafish (1:50, Anaspec, AS-55708), mouse anti-NeuroD1 (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... 20 µM cdk5 substrate peptide (PKTPKKAKKL, Anaspec #60026-1). The reaction was allowed to proceed for 25 minutes ...
-
bioRxiv - Neuroscience 2021Quote: ... and rabbit anti-P2Y12 (AnaSpec, AS-55043A, 1:1000) were used for immunostaining ...
-
bioRxiv - Immunology 2022Quote: ... anti-P2Y12 (1: 500, AnaSpec, SQ-ANAB-78839, discontinued). Appropriate secondary antibodies were purchased from Leica or Vectorlab ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-P2RY12 (1:300, catalog no. 55043A, AnaSpec), mouse anti-SMI32 (1:1,000 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-P2RY12 (1:300, catalog no. 55043A, AnaSpec); rabbit anti-GAL3 (1:1,000 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Biochemistry 2023Quote: ... followed by HRP-conjugated secondary antibody (Anaspec, 1:2000). Antibodies were dissolved in 1X TBS with 0.05% Tween-20 ...
-
bioRxiv - Cell Biology 2024Quote: ... ISCs (2,000 cells) and Paneth cells (2000 cells) were then seeded into 30 μl Matrigel containing 1 μM Jagged-1 (AnaSpec, San Jose, CA) and 10 μM Y-27632 ...
-
bioRxiv - Neuroscience 2021Quote: ... with a total 200μg MOG35-55 (AnaSpec, AS-60130-1) per mouse was injected subcutaneously into all 4 flanks ...
-
bioRxiv - Cell Biology 2022Quote: ... and nuclei stained using Hoescht 33342 (1:1000, AnaSpec Inc.). Slides were mounted using Fluoromount-G (SouthernBiotech ...
-
bioRxiv - Immunology 2021Quote: ... cells were pulsed with 1 ng/ml SIINFEKL peptide (AnaSpec) for 30 min ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Cell Biology 2019Quote: Fibril/aggregation formation of 15 μM β-amyloid (1-42) (Anaspec) or purified 20 μM α-synuclein A53T ...
-
bioRxiv - Neuroscience 2020Quote: ... sections were stained with anti-P2Y12 (1:100, Anaspec #AS-55043A) or anti-GFAP (1:200 ...
-
bioRxiv - Neuroscience 2022Quote: ... hPTH (1-34)-Lys (Biotin) (20 μg/mL, AnaSpec, AS-23647) and Biotin (1 μg/mL,Sigma ...
-
bioRxiv - Neuroscience 2021Quote: ... they were incubated with rabbit anti-P2Y12R (1:500, #55043AS AnaSpec) alone or mixed with mouse anti-GFAP (1:1000 ...
-
bioRxiv - Cell Biology 2020Quote: ... cells were stained with 1 µg/mL DAPI (AnaSpec Inc 83210) in BY-2 media for 10 minutes ...
-
TNFR1/p38αMAPK signaling in Nex+ supraspinal neurons regulates sex-specific chronic neuropathic painbioRxiv - Neuroscience 2023Quote: ... nuclei were stained with Hoechst 33258 (1:10000, Anaspec AS-83219), and then slides were cover-slipped (Fluoro-Gel ...
-
bioRxiv - Neuroscience 2023Quote: ... The primary antibodies to rabbit anti-Elp1 (1:1500) (Anaspec, #AS_54494)) and rabbit anti-GFP (1:2000 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-MMP2 (AS-55111, 1:250; AnaSpec, Fremont, CA, USA), mouse anti-TH (1:1000 ...
-
bioRxiv - Genetics 2019Quote: ... H3(1-21) and H3(21-44) peptides were ordered from Anaspec, and H3(1-43 ...
-
bioRxiv - Developmental Biology 2019Quote: ... Primary antibodies Rabbit anti-Vangl2 (1:100, Anaspec, AS-55659s, now discontinued) and Mouse anti β-II-Spectrin (1:200 ...
-
bioRxiv - Neuroscience 2023Quote: ... Anaspec) were initially resuspended in 1% NH4OH (cat no: AS-61322, Anaspec) for 15 min to dissolve any pre-formed aggregates per manufacturer instructions ...
-
bioRxiv - Developmental Biology 2019Quote: ... Western Blot was performed using 1:500 dilution of Celsr1a antibody (AnaSpec. Inc).
-
bioRxiv - Biochemistry 2019Quote: ... MGP 1-64 (the first 64 amino acids of matrix Gla protein, Anaspec), 1 uM ...
-
bioRxiv - Neuroscience 2021Quote: ... The following primary antibodies were used: rabbit anti-P2Y12R (1:500, #55043AS AnaSpec), chicken anti-GFP-tag (1:500 ...
-
bioRxiv - Cancer Biology 2022Quote: ... green (HiLyte Fluor 488) florescent β-amyloid (1 - 42) peptide (Anaspec, Fremont, CA) was used ...
-
bioRxiv - Physiology 2022Quote: ... mixed with the peptide substrate library (Anaspec #AS-62017-1 and #AS-62335), kinase assay buffer I (SignalChem ...