Labshake search
Citations for Anaspec :
51 - 97 of 97 citations for Rabbit Anti Human IgG gamma chain Alexa Fluor 660 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... and labeled with HiLyte647 (HiLyte Fluor 647 succinimidyl ester; Anaspec, 81256), rhodamine (5-(and-6)-carboxytetramethylrhodamine succinimidyl ester ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Immunology 2021Quote: ... slides were incubated in blocking at RT for 1 h before overnight incubation at 4°C with the primary rabbit anti-P2Y12 receptor antibody (1:200, AnaSpec #AS-55043A) and labelling for 1 hour with the secondary antibody AF488 goat anti-rabbit ...
-
bioRxiv - Biophysics 2022Quote: ... αS was fluorescently labeled using HiLyte™ Fluor 405 succinimidyl ester (Anaspec). Monomeric αS in 20 mM MES buffer pH 6.0 was incubated with 3 molar excess of dye and incubated at 4 °C for 16 h ...
-
Intra-mitochondrial proteostasis is directly coupled to alpha-synuclein and Amyloid β 1-42 pathologybioRxiv - Neuroscience 2020Quote: Synthetic Aβ42 and Aβ42 Hilyte™ Fluor 488 (both from Anaspec, Seraing, Belgium) were prepared as previously described (89) ...
-
bioRxiv - Neuroscience 2021Quote: ... HiLyte™ Fluor 488-labeled amyloid β peptide 25-35 (Anaspec, AS-633308) was prepared according to the manufacturer’s protocol ...
-
bioRxiv - Cancer Biology 2022Quote: ... green (HiLyte Fluor 488) florescent β-amyloid (1 - 42) peptide (Anaspec, Fremont, CA) was used ...
-
bioRxiv - Neuroscience 2022Quote: Phagocytosis of iMGLs was evaluated with fluorescent HiLyte Fluor 488 Aβ1-42 (AnaSpec) and by pHrodo BioParticle (Invitrogen ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2021Quote: ... Fluorescent labeling of GRNs was performed using HiLyte™ Fluor 405 succinimidyl ester (Anaspec) or HiLyte™ Fluor 647 succinimidyl ester for FRAP studies on GRNs ...
-
bioRxiv - Biophysics 2021Quote: ... Fluorescent labeling of PrLD was performed using HiLyte™ Fluor 647 succinimidyl ester (Anaspec) using a similar protocol as described above for GRNs.
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Neuroscience 2019Quote: ... recombinant SHSY5Y cells were incubated with varying concentrations of Aβ42 (HiLyte Fluor labeled Aβ42, Anaspec) (50 ...
-
bioRxiv - Biochemistry 2020Quote: Fluorescent (HiLyte™ Fluor 488) labeled Aβ42 was purchased for cell culture assays from Anaspec (sequence ...
-
bioRxiv - Physiology 2023Quote: 0.1 mg of lyophilized HiLyte Fluor 488-labeled amyloid-β1-42 (Anaspec AS-60479-01) was dissolved in 50 µL of 1% NH4OH and diluted to 0.5 mg/mL with 1xPBS before aliquoting for storage at −20°C until further use ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
DIET INFLUENCES PERIPHERAL AMYLOID β METABOLISM: A ROLE FOR CIRCULATING INSULIN-LIKE GROWTH FACTOR IbioRxiv - Neuroscience 2020Quote: In vitro: Cells were treated during 15 hours with 500 nM soluble Aβ40-HiLyte Fluor™ 488 (AnaSpec) (68) ...
-
bioRxiv - Neuroscience 2020Quote: Fluorescent Aβ42 oligomers and fibrils were prepared similarly with HiLyte Fluor 555-labeled Aβ42 (Anaspec, AS-60480-01) and mixed with non-labeled Aβ42 peptides in a 1:2 ratio.
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2022Quote: Synthetic Aβ42 (>95%, Eurogenentec) and Aβ42 Hilyte™ Fluor 488 (>95%, labelled at the N-terminus) were purchased from Anaspec as lyophilised powder ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Neuroscience 2020Quote: ... primary microglia were treated with 2μM (final concentration) of fibrillar fluorescent Aβ42 conjugated to HiLyte Fluor 488 (fAβ42-488, AnaSpec, Cat. No. AS-60479-01) for 1 hour at 37°C ...
-
bioRxiv - Cell Biology 2020Quote: ... was labelled with AnaTag Hilyte™ Fluor 594 and purified truncated PE constructs were labelled with AnaTag Hilyte™ Fluor 488 according to the manufacturer’s instructions (#72048, AnaSpec, Fremont, CA). Cells were seeded onto glass coverslips in 6-well dishes (Thermo Fisher Scientific ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-P2RY12 (1:1000; AnaSpec, Fremont, CA), anti-GFAP (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-P2ry12 (AS-55043A, AnaSpec, 1:1000), anti-Tmem119 (ab209064 ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2020Quote: ... and anti GFP (chicken, Anaspec/Tebu; 1/1000). Appropriate secondary antibodies were used (goat anti-mouse Alexa 546 Vector ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... and incubated overnight at 4ºC with the primary antibody: rabbit polyclonal antibody against P2RY12 (1:250, #AS-55043A, AnaSpec Inc.). The secondary antibody was ...
-
bioRxiv - Immunology 2022Quote: ... anti-P2Y12 (1: 500, AnaSpec, SQ-ANAB-78839, discontinued). Appropriate secondary antibodies were purchased from Leica or Vectorlab ...
-
bioRxiv - Neuroscience 2020Quote: ... sections were stained with anti-P2Y12 (1:100, Anaspec #AS-55043A) or anti-GFAP (1:200 ...
-
bioRxiv - Molecular Biology 2019Quote: Primary antibodies used for immunoblotting were as follows: anti-IKAP (Anaspec, cat# 54494), anti-acetylated α-tubulin (Sigma ...
-
bioRxiv - Plant Biology 2023Quote: ... the sections were reacted with polyclonal anti-GFP antibody (AnaSpec, Fremont, CA, US) diluted 1:500 in 3% (w/v ...
-
bioRxiv - Cell Biology 2023Quote: ... the sections were reacted with polyclonal anti-GFP antibody (AnaSpec, Fremont, CA, US) diluted 1:500 in 3% (w/v ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We incubated the washed beads with 0.25 mg/mL mouse monoclonal biotinylated anti-His Tag monoclonal antibody (AS-61250-BIOT, Anaspec Inc., Fremont, CA) for 2 hours at 22°C ...