Labshake search
Citations for Anaspec :
51 - 100 of 106 citations for Rabbit Anti Human IgG gamma chain Alexa Fluor 660 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... HiLyte™ Fluor 555-labeled (Cat. AS-60480-01, ANASPEC) were dissolved in DMSO to obtain a 1 mM stock ...
-
bioRxiv - Neuroscience 2024Quote: ... HiLyte™ Fluor 647-labeled (Anaspec Inc., Cat#: AS- 64161) was resuspended to a 4µM stock in 50µl 1% Na4OH and 3950µl Corning™ Eagle’s Minimum Essential Medium (MEM ...
-
bioRxiv - Cell Biology 2024Quote: ... amyloid-beta-42 labeled with HiLyte Fluor-555 peptide (AnaSpec) and pHrodo Zymosan BioParticles (Invitrogen).
-
bioRxiv - Neuroscience 2024Quote: ... HiLyte Fluor 647 beta-amyloid (1-42) (# AS-64161, Anaspec) was fibrillized as described above ...
-
bioRxiv - Neuroscience 2024Quote: HiLyte Fluor 647 beta-amyloid (1-42) (# AS-64161, Anaspec) was fibrillized as described previously (Amos et al. ...
-
bioRxiv - Neuroscience 2023Quote: ... for 30 min and incubated with blocking solution (5% normal bovine serum in PBST) for 1 h followed by rabbit anti-P2Y12 antibody (AS-55043A, AnaSpec) together with goat anti-Iba1 antibody (ab5076 ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Cell Biology 2023Quote: ... and labeled with HiLyte647 (HiLyte Fluor 647 succinimidyl ester; Anaspec, 81256), rhodamine (5-(and-6)-carboxytetramethylrhodamine succinimidyl ester ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Immunology 2021Quote: ... slides were incubated in blocking at RT for 1 h before overnight incubation at 4°C with the primary rabbit anti-P2Y12 receptor antibody (1:200, AnaSpec #AS-55043A) and labelling for 1 hour with the secondary antibody AF488 goat anti-rabbit ...
-
bioRxiv - Biophysics 2022Quote: ... αS was fluorescently labeled using HiLyte™ Fluor 405 succinimidyl ester (Anaspec). Monomeric αS in 20 mM MES buffer pH 6.0 was incubated with 3 molar excess of dye and incubated at 4 °C for 16 h ...
-
Intra-mitochondrial proteostasis is directly coupled to alpha-synuclein and Amyloid β 1-42 pathologybioRxiv - Neuroscience 2020Quote: Synthetic Aβ42 and Aβ42 Hilyte™ Fluor 488 (both from Anaspec, Seraing, Belgium) were prepared as previously described (89) ...
-
bioRxiv - Neuroscience 2021Quote: ... HiLyte™ Fluor 488-labeled amyloid β peptide 25-35 (Anaspec, AS-633308) was prepared according to the manufacturer’s protocol ...
-
bioRxiv - Cancer Biology 2022Quote: ... green (HiLyte Fluor 488) florescent β-amyloid (1 - 42) peptide (Anaspec, Fremont, CA) was used ...
-
bioRxiv - Neuroscience 2022Quote: Phagocytosis of iMGLs was evaluated with fluorescent HiLyte Fluor 488 Aβ1-42 (AnaSpec) and by pHrodo BioParticle (Invitrogen ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2021Quote: ... Fluorescent labeling of GRNs was performed using HiLyte™ Fluor 405 succinimidyl ester (Anaspec) or HiLyte™ Fluor 647 succinimidyl ester for FRAP studies on GRNs ...
-
bioRxiv - Biophysics 2021Quote: ... Fluorescent labeling of PrLD was performed using HiLyte™ Fluor 647 succinimidyl ester (Anaspec) using a similar protocol as described above for GRNs.
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Neuroscience 2019Quote: ... recombinant SHSY5Y cells were incubated with varying concentrations of Aβ42 (HiLyte Fluor labeled Aβ42, Anaspec) (50 ...
-
bioRxiv - Biochemistry 2020Quote: Fluorescent (HiLyte™ Fluor 488) labeled Aβ42 was purchased for cell culture assays from Anaspec (sequence ...
-
bioRxiv - Physiology 2023Quote: 0.1 mg of lyophilized HiLyte Fluor 488-labeled amyloid-β1-42 (Anaspec AS-60479-01) was dissolved in 50 µL of 1% NH4OH and diluted to 0.5 mg/mL with 1xPBS before aliquoting for storage at −20°C until further use ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
DIET INFLUENCES PERIPHERAL AMYLOID β METABOLISM: A ROLE FOR CIRCULATING INSULIN-LIKE GROWTH FACTOR IbioRxiv - Neuroscience 2020Quote: In vitro: Cells were treated during 15 hours with 500 nM soluble Aβ40-HiLyte Fluor™ 488 (AnaSpec) (68) ...
-
bioRxiv - Neuroscience 2020Quote: Fluorescent Aβ42 oligomers and fibrils were prepared similarly with HiLyte Fluor 555-labeled Aβ42 (Anaspec, AS-60480-01) and mixed with non-labeled Aβ42 peptides in a 1:2 ratio.
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Immunology 2024Quote: MDMi treated with various conditions were incubated with 10 uM HyLite Fluor 647-labeled Aβ1-42 peptide (AnaSpec) for 1 hour at 37°C.
-
bioRxiv - Molecular Biology 2022Quote: Synthetic Aβ42 (>95%, Eurogenentec) and Aβ42 Hilyte™ Fluor 488 (>95%, labelled at the N-terminus) were purchased from Anaspec as lyophilised powder ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Neuroscience 2020Quote: ... primary microglia were treated with 2μM (final concentration) of fibrillar fluorescent Aβ42 conjugated to HiLyte Fluor 488 (fAβ42-488, AnaSpec, Cat. No. AS-60479-01) for 1 hour at 37°C ...
-
bioRxiv - Cell Biology 2020Quote: ... was labelled with AnaTag Hilyte™ Fluor 594 and purified truncated PE constructs were labelled with AnaTag Hilyte™ Fluor 488 according to the manufacturer’s instructions (#72048, AnaSpec, Fremont, CA). Cells were seeded onto glass coverslips in 6-well dishes (Thermo Fisher Scientific ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-P2RY12 (1:1000; AnaSpec, Fremont, CA), anti-GFAP (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-P2ry12 (AS-55043A, AnaSpec, 1:1000), anti-Tmem119 (ab209064 ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2020Quote: ... and anti GFP (chicken, Anaspec/Tebu; 1/1000). Appropriate secondary antibodies were used (goat anti-mouse Alexa 546 Vector ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... and incubated overnight at 4ºC with the primary antibody: rabbit polyclonal antibody against P2RY12 (1:250, #AS-55043A, AnaSpec Inc.). The secondary antibody was ...