Labshake search
Citations for Aves Labs :
1 - 50 of 407 citations for Rabbit Anti Human IgG Fc Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... chicken anti-human IBA1 (Aves Labs, IBA1-0020), mouse anti-human TMEM119 (Cell Signaling Technology ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies (rabbit anti-cFos, Cell Signaling Technology, 1:500; chicken anti-GFP, Aves Labs, 1:1500) diluted in blocking buffer were added to sections overnight at room temp ...
-
bioRxiv - Neuroscience 2022Quote: ... Sections were then incubated with primary antibodies (chicken anti-GFP Aves Lab 1:1000, rabbit anti-dsRed Abcam 1:1000) that were diluted in the Blocking buffer (1%BSA ...
-
bioRxiv - Developmental Biology 2019Quote: ... the staining of the endothelium was performed with anti-GFP (rabbit, Aves Labs, inc.) and Alexa Fluor 488 (anti rabbit ...
-
bioRxiv - Cell Biology 2023Quote: ... Sections/coverslips were then incubated with primary antibodies (chicken anti-GFP Aves Lab 1:4000, rabbit anti-dsRed Abcam 1:4000) that were diluted in the Blocking buffer (1%BSA ...
-
bioRxiv - Developmental Biology 2022Quote: ... rabbit anti-ASE (1:400) (Weng et al. 2010) and chicken anti-GFP Antibody (1:2000) (Aves Labs, Davis, CA, Cat #GFP-1020).
-
bioRxiv - Neuroscience 2019Quote: ... anti-GFP (rat, 04404-84, Nacalai Tesque, 1:500; rabbit, 598, MBL, 1:500; chick, GFP-1020, Aves Labs, 1:500). After washes ...
-
bioRxiv - Neuroscience 2024Quote: ... to stain cells infected with adeno-associated viruses expressing mCherry or against GFP (using a combination of two rabbit anti-GFP antibodies, 1:500, Aves Labs #GFP-1020 and Abcam #ab13970) to reveal the endogenous GFP signal of MGE-derived cells labeled with an RCE reporter ...
-
bioRxiv - Cancer Biology 2019Quote: ... Anti-GFAP (Aves Labs) 1:2000 ...
-
bioRxiv - Immunology 2019Quote: ... and anti-GFP (Aves Labs). Alexa Fluor 488 goat anti-chicken and Alexa Fluor 568 goat anti-rabbit (Invitrogen ...
-
A Polybasic Domain in aPKC Mediates Par6-Dependent Control of Membrane Targeting and Kinase ActivitybioRxiv - Cell Biology 2020Quote: ... chicken anti-GFP (Aves Lab) 1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (Aves labs), goat anti-IBA1 (Novus) ...
-
bioRxiv - Bioengineering 2023Quote: ... Anti-GFP from Aves Labs, Cat# GFP-1020 ...
-
bioRxiv - Developmental Biology 2023Quote: ... chicken anti-GFP (Aves Labs) 1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... Sections were immunohistochemically stained with an anti-GFP antibody (chicken anti-GFP, 1:2000; Aves Labs) and stored overnight at room temperature ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves lab; RRID:AB_2307313), goat anti-GFP (Sicgen ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-MBP (Aves lab; RRID:AB_2313550), rabbit anti-GFAP (Agilent ...
-
bioRxiv - Cell Biology 2022Quote: ... 1407 Chicken anti-PG (Aves Laboratories); 2G9 Mouse anti-B55α (Cell Signaling Technology) ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken polyclonal anti-GFP (Aves Lab, GFP-1020 ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Tau (1:100; Aves Labs), and anti-Beta tubulin III (Tuj1 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-GFP (Aves Labs, #GFP-1020); anti-NM-IIB αCT (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-GFP (Aves Lab, GFP-1020), anti-KRT14 (Covance ...
-
bioRxiv - Cell Biology 2024Quote: ... anti-GFP (Aves Labs GFP-1020) at 1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies specific to TH (Rabbit 1:1000, Thermo Fisher Scientific, #P40101150; Chicken 1:500, Aves Labs, TYH), GFP (Chicken 1:500 ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (Aves Lab, GFP-1010), 1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Biophysics 2021Quote: ... Chicken anti-GFP (GFP-1010, Aves Labs); Mouse anti-GFP (2A3 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken anti-GFP (Aves labs, GFP-1020), chicken anti-beta-Galactosidase (abcam ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
bioRxiv - Developmental Biology 2020Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-GFP (Aves Labs, GFP-1010, chicken).