Rabbit Anti Borrelia burgdorferi sensu stricto B31 Erpd Arp37 Antibody citations for Aves Labs

Loss of the Er81 Transcription Factor in Cholinergic Cells Alters Striatal Activity and Habit Formation

Yadollah Ranjbar-Slamloo, et al., bioRxiv - Neuroscience 2020

Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...

Vanishing White Matter Disease Expression of Truncated EIF2B5 Activates Induced Stress Response

Matthew D. Keefe, et al., bioRxiv - Physiology 2020

Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...

Decisions in an Innate Behavioral Sequence

Kevin M. Cury, Richard Axel, bioRxiv - Neuroscience 2021

Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...

Mating disrupts morning anticipation in Drosophila melanogaster females

Sabrina Riva, et al., bioRxiv - Neuroscience 2022

Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...

Cortical integration of higher-order thalamic inputs is lineage-dependent

Matthew J. Buchan, et al., bioRxiv - Neuroscience 2022

Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...

A novel Wnt pathway orients Par complex-dependent cell polarity

Shigeki Yoshiura, Fumio Matsuzaki, bioRxiv - Cell Biology 2022

Quote: ... chicken anti-GFP (Aves labs, GFP-1020), chicken anti-beta-Galactosidase (abcam ...

McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylation

Marina Arbi, et al., bioRxiv - Molecular Biology 2022

Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...

Interactions with presynaptic photoreceptors mediated by the Dpr11 and DIP-γ cell surface proteins control selection and survival of Drosophila amacrine neurons

Kaushiki P. Menon, et al., bioRxiv - Neuroscience 2019

Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...

TRESK K⁺ Channel Activity Regulates Trigeminal Nociception and Headache

Zhaohua Guo, et al., bioRxiv - Neuroscience 2019

Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...

Discovery of Alstrom syndrome gene as a regulator of centrosome duplication in asymmetrically dividing stem cells in Drosophila

Cuie Chen, Yukiko M. Yamashita, bioRxiv - Developmental Biology 2019

Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...

Regulation of perineuronal nets in the adult cortex by the electrical activity of parvalbumin interneurons

Gabrielle Devienne, et al., bioRxiv - Neuroscience 2019

Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...

Notch signaling coordinates ommatidial rotation in the Drosophila eye via transcriptional regulation of the EGF-Receptor ligand Argos

Yildiz Koca, et al., bioRxiv - Developmental Biology 2019

Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...

Zebrafish follistatin-like 1b regulates cardiac contraction during early development

Xin-Xin I. Zeng, et al., bioRxiv - Developmental Biology 2020

Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...

12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune Diabetes

Abhishek Kulkarni, et al., bioRxiv - Immunology 2021

Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...

Homeodomain-less MEIS1 suppresses CUL3-dependent ATOH1 degradation to regulate cerebellar granule cell development

Tomoo Owa, et al., bioRxiv - Cell Biology 2022

Quote: ... anti-GFP (Aves Labs, GFP-1010, chicken).

Aging Fly Cell Atlas Identifies Exhaustive Aging Features at Cellular Resolution

Tzu-Chiao Lu, et al., bioRxiv - Developmental Biology 2022

Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...

Neural correlates of individual odor preference in Drosophila

Matthew A. Churgin, et al., bioRxiv - Neuroscience 2023

Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...

Oligodendrocyte dynamics dictate individual performance outcomes of working memory training in mice

Takahiro Shimizu, et al., bioRxiv - Neuroscience 2023

Quote: ... anti-YFP (chicken, Aves labs, 1:1,000), anti-Pdgfra (rabbit ...

A rapid and bidirectional reporter of neural activity reveals neural correlates of social behaviors in Drosophila

Moise Bonheur, et al., bioRxiv - Neuroscience 2023

Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...

In vivo screening of tumor-hepatocyte interactions identifies Plexin B2 as a gatekeeper of liver metastasis

Costanza Borrelli, et al., bioRxiv - Cancer Biology 2023

Quote: ... and anti-GFP (Aves Labs #GFP-1020). Sections were repeatedly washed in PBST and incubated with the following secondary antibodies (1:400 ...

Neuronal potassium channel activity triggers initiation of mRNA translation through binding of translation regulators

Taylor J. Malone, et al., bioRxiv - Neuroscience 2024

Quote: ... anti-Slack 1:5000 (Aves labs: custom), anti-puromycin 1:1000 (Millipore Sigma ...

Optineurin-facilitated axonal mitochondria delivery promotes neuroprotection and axon regeneration

Dong Liu, et al., bioRxiv - Neuroscience 2024

Quote: ... Chick anti-GFP (1:1000, Aves Lab), or Rabbit anti-GAPDH (1:1000 ...

A new look at the architecture and dynamics of the Hydra nerve net

Athina Keramidioti, et al., bioRxiv - Neuroscience 2024

Quote: ... anti-GFP (chicken) 1/500 (Aves Lab).

Rapid and efficient in vivo astrocyte-to-neuron conversion with regional identity and connectivity?

Lei-Lei Wang, et al., bioRxiv - Neuroscience 2020

Quote: ... The following primary antibodies were used: GFP (Chicken; 1:2000; Aves Labs), mCherry (Goat ...

Frontal cortical regulation of neurogenesis and cellular proliferation in the ventral subventricular zone

Moawiah M Naffaa, et al., bioRxiv - Neuroscience 2022

Quote: ... We used primary antibodies to GFP (#GFP-1020, 1:400, AVES lab), Choline Acetyltransferase Antibody (#AB144P ...

Actomyosin-II Proactively Shields Axons of the Central Nervous System from Mild Mechanical Stress

Xiaorong Pan, et al., bioRxiv - Neuroscience 2023

Quote: ... followed by adding primary antibody GFP (1:1000; Aves Labs, #GFP-1020), which was incubated overnight at 4°C ...

Defining the molecular identity and morphology of glia limitans superficialis astrocytes in mouse and human

Philip Hasel, et al., bioRxiv - Neuroscience 2023

Quote: Hemispheres were incubated in primary antibody (Aves lab, GFP-1020, 1:1000) diluted in PTxwH for 1 week at 37 °C with rotation ...

Characterization of liver-pancreas crosstalk following β-cell loss reveals a role for the molybdenum cofactor in β-cell regeneration

Christos Karampelias, et al., bioRxiv - Developmental Biology 2024

Quote: ... Primary antibodies were used against GFP (1:500; Aves Labs GFP-1020), insulin (1:100 ...

Characterizing and targeting glioblastoma neuron-tumor networks with retrograde tracing

Svenja K. Tetzlaff, et al., bioRxiv - Cancer Biology 2024

Quote: ... For immunolabeling primary antibodies for against GFP (catalog # GFP-1020, Aves Labs) and against RFP (catalog # 600-401-379 ...

Asymmetric Hapln1a drives regionalised cardiac ECM expansion and promotes heart morphogenesis during zebrafish development

Christopher J Derrick, et al., bioRxiv - Developmental Biology 2019

Quote: ... The following commercially available primary antibodies were used: αGFP (1:1000 Aves lab), αCT3 (1:100 ...

Molecular mechanisms controlling the biogenesis of the TGF-β signal Vg1

P. C. Dave P. Dingal, et al., bioRxiv - Developmental Biology 2023

Quote: Primary antibodies were used against GFP (1:1000 chicken IgY, Aves Lab, RRID:AB_2307313) and phosphorylated Smad2 (1:1000 rabbit IgG ...

Mitochondrial fission, integrity and completion of mitophagy require separable functions of Vps13D in Drosophila neurons

Ryan Insolera, et al., bioRxiv - Cell Biology 2020

Quote: ... anti GFP at 1:1000 (Aves Labs #GFP1020), anti GFP at 1:1000 (Life Technologies #A6455) ...

The feedback regulator Nord controls Dpp/BMP signaling via extracellular interaction with Dally in the Drosophila wing

Takuya Akiyama, et al., bioRxiv - Developmental Biology 2021

Quote: ... and chicken anti-GFP (GFP-1010, Aves Labs). Can Get Signal Immunostain Solution B (NKB-601 ...

FUS-ALS mutants alter FMRP phase separation equilibrium and impair protein translation

N. Birsa, et al., bioRxiv - Neuroscience 2020

Quote: ... anti-GFP (IF 1:1000, GFP1011, Aves labs), anti-FMRP (IF 1:300 ...

Single-cell analysis of the ventricular-subventricular zone reveals signatures of dorsal and ventral adult neurogenic lineages

Stephanie A. Redmond, et al., bioRxiv - Neuroscience 2021

Quote: ... Chicken anti-GFP (Aves labs, GFP1020, 1:400), Rabbit anti-HOPX (Proteintech,11419-1-AP,1:500)(Supplementary Table 5) ...

Arp2/3 and Unc45 maintain heterochromatin stability in Drosophila polytene chromosomes

George Dialynas, Laetitia Delabaere, Irene Chiolo, bioRxiv - Cell Biology 2019

Quote: ... anti-GFP (1:1000 Aves Lab, GFP-1020); anti-H3K9me2 (1:750 ...

Neuropilin 2 signaling mediates corticostriatal transmission, spine maintenance, and goal-directed learning in mice

Maxime Assous, et al., bioRxiv - Neuroscience 2019

Quote: ... chicken polyclonal anti-GFP (1:1000, Aves Labs) and for visualization ...

Sensory Neurons Innervate Peripheral Lymph Nodes and Locally Regulate Gene Expression in Postsynaptic Endothelium, Stromal Cells, and Innate Leukocytes

Siyi Huang, et al., bioRxiv - Immunology 2019

Quote: ... chicken anti-NF200 (Aves Labs, NFH, 1:500), rabbit anti-Tyrosine Hydroxylase (Millipore ...

Selective axonal translation of prenylated Cdc42 mRNA isoform supports axon growth

Seung Joon Lee, et al., bioRxiv - Neuroscience 2020

Quote: ... and chicken anti-NF (1:1,000, Aves labs) was used for primary antibodies and FITC-conjugated donkey anti-Rabbit (1:200 ...

Therapeutic Reversal of Chemically Induced Parkinson Disease by Converting Astrocytes into Nigral Neurons