Labshake search
Citations for Aves Labs :
1 - 50 of 497 citations for Mouse anti Plasmodium vivax MSP1 PVM 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: ... For mouse tissues chicken anti-GFP (Aves Labs; GFP-1020; 1:500) and rabbit anti-laminin (Abcam ...
-
bioRxiv - Microbiology 2023Quote: ... slides were first stained with 1:200 Mouse monoclonal LAMP-1 (DSHB) and 1:1000 Chicken anti-Salmonella (Aves Labs) for 1 hour at room temperature ...
-
bioRxiv - Cell Biology 2020Quote: ... and incubated with 1° antibodies for 1hr at 37°C (mouse anti-EPS8, BD Transduction Laboratories Cat#610144 1:400; Chicken IgY anti-GFP, Cat#GFP-1020 Aves Labs 1:200). Cells were then rinsed 4x for 5 minutes with PBS and incubated with 2° antibodies (Goat anti-mouse Alexa Fluor 488 F(ab’)2 fragment ...
-
bioRxiv - Neuroscience 2024Quote: ... overnight at room temperature in primary antibody 1:1000 mouse anti-GFP (GFP-1010, Aves Labs), or anti-Myc (Santa Cruz ...
-
bioRxiv - Biophysics 2021Quote: ... The following primary antibodies were used: mouse Zns5 at 1:250 (Zebrafish International Resource Center) and chicken anti-GFP at 1:2000 (GFP-1010, Aves Labs). The secondary antibodies (at 1:500 ...
-
bioRxiv - Cell Biology 2021Quote: ... Antibodies were used at the following dilutions: Mouse anti α-GFP (Aves Labs Inc., Tigard, Oregon, 1:500), Rat anti-HA (Roche ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Tau (1:100; Aves Labs), and anti-Beta tubulin III (Tuj1 ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies (rabbit anti-cFos, Cell Signaling Technology, 1:500; chicken anti-GFP, Aves Labs, 1:1500) diluted in blocking buffer were added to sections overnight at room temp ...
-
bioRxiv - Cell Biology 2020Quote: ... chicken anti-GFP (GFP-1020, Aves Labs; ExM, 1: 1:250), mouse anti-centrin 1 (clone 20H5 ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
bioRxiv - Developmental Biology 2020Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Developmental Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-YFP (chicken, Aves labs, 1:1,000), anti-Pdgfra (rabbit ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-Slack 1:5000 (Aves labs: custom), anti-puromycin 1:1000 (Millipore Sigma ...
-
bioRxiv - Neuroscience 2024Quote: ... Chick anti-GFP (1:1000, Aves Lab), or Rabbit anti-GAPDH (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-GFP (chicken) 1/500 (Aves Lab).
-
bioRxiv - Neuroscience 2022Quote: ... Sections were then incubated with primary antibodies (chicken anti-GFP Aves Lab 1:1000, rabbit anti-dsRed Abcam 1:1000) that were diluted in the Blocking buffer (1%BSA ...
-
bioRxiv - Cell Biology 2020Quote: ... anti GFP at 1:1000 (Aves Labs #GFP1020), anti GFP at 1:1000 (Life Technologies #A6455) ...
-
bioRxiv - Neuroscience 2020Quote: ... anti-GFP (IF 1:1000, GFP1011, Aves labs), anti-FMRP (IF 1:300 ...
-
bioRxiv - Neuroscience 2021Quote: ... Chicken anti-GFP (Aves labs, GFP1020, 1:400), Rabbit anti-HOPX (Proteintech,11419-1-AP,1:500)(Supplementary Table 5) ...
-
bioRxiv - Cell Biology 2019Quote: ... anti-GFP (1:1000 Aves Lab, GFP-1020); anti-H3K9me2 (1:750 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken polyclonal anti-GFP (1:1000, Aves Labs) and for visualization ...
-
bioRxiv - Immunology 2019Quote: ... chicken anti-NF200 (Aves Labs, NFH, 1:500), rabbit anti-Tyrosine Hydroxylase (Millipore ...
-
bioRxiv - Neuroscience 2020Quote: ... and chicken anti-NF (1:1,000, Aves labs) was used for primary antibodies and FITC-conjugated donkey anti-Rabbit (1:200 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000), Rabbit anti-PSD95 (Cell Signaling ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFAP (Aves lab, GFAP, 1:100), Rabbit anti-ALDH1L1 (EnCor Biotechnology ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000) and Rabbit anti-VMAT2 (Proteintech ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NSE (Aves lab, NSE, 1:1000), Rabbit anti-VGlut1 (Synaptic Systems ...