Labshake search
Citations for Aves Labs :
1 - 50 of 405 citations for Mouse anti Mayaro Virus E2 M988 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: Immunostaining was conducted for axonal projections and verification of virus expression using a chicken anti-GFP polyclonal antibody (1:1000, Cat # GFP-1020, RRID:AB_10000240; Aves Labs, CA, U.S.A.) or a rabbit anti-DsRed polyclonal antibody (1:1000 ...
-
bioRxiv - Cancer Biology 2023Quote: ... For mouse tissues chicken anti-GFP (Aves Labs; GFP-1020; 1:500) and rabbit anti-laminin (Abcam ...
-
bioRxiv - Cell Biology 2020Quote: ... and incubated with 1° antibodies for 1hr at 37°C (mouse anti-EPS8, BD Transduction Laboratories Cat#610144 1:400; Chicken IgY anti-GFP, Cat#GFP-1020 Aves Labs 1:200). Cells were then rinsed 4x for 5 minutes with PBS and incubated with 2° antibodies (Goat anti-mouse Alexa Fluor 488 F(ab’)2 fragment ...
-
bioRxiv - Neuroscience 2024Quote: ... overnight at room temperature in primary antibody 1:1000 mouse anti-GFP (GFP-1010, Aves Labs), or anti-Myc (Santa Cruz ...
-
bioRxiv - Cell Biology 2020Quote: ... Affinity-purified chicken anti-WHIMP antibodies were generated against mouse WHIMP amino acids 9-21 (Aves Labs). Other antibodies were rabbit anti-MBP [68] ...
-
bioRxiv - Cell Biology 2021Quote: ... Antibodies were used at the following dilutions: Mouse anti α-GFP (Aves Labs Inc., Tigard, Oregon, 1:500), Rat anti-HA (Roche ...
-
bioRxiv - Microbiology 2023Quote: ... slides were first stained with 1:200 Mouse monoclonal LAMP-1 (DSHB) and 1:1000 Chicken anti-Salmonella (Aves Labs) for 1 hour at room temperature ...
-
bioRxiv - Biophysics 2021Quote: ... The following primary antibodies were used: mouse Zns5 at 1:250 (Zebrafish International Resource Center) and chicken anti-GFP at 1:2000 (GFP-1010, Aves Labs). The secondary antibodies (at 1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... Anti-GFAP (Aves Labs) 1:2000 ...
-
bioRxiv - Immunology 2019Quote: ... and anti-GFP (Aves Labs). Alexa Fluor 488 goat anti-chicken and Alexa Fluor 568 goat anti-rabbit (Invitrogen ...
-
A Polybasic Domain in aPKC Mediates Par6-Dependent Control of Membrane Targeting and Kinase ActivitybioRxiv - Cell Biology 2020Quote: ... chicken anti-GFP (Aves Lab) 1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (Aves labs), goat anti-IBA1 (Novus) ...
-
bioRxiv - Bioengineering 2023Quote: ... Anti-GFP from Aves Labs, Cat# GFP-1020 ...
-
bioRxiv - Developmental Biology 2023Quote: ... chicken anti-GFP (Aves Labs) 1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... Sections were immunohistochemically stained with an anti-GFP antibody (chicken anti-GFP, 1:2000; Aves Labs) and stored overnight at room temperature ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves lab; RRID:AB_2307313), goat anti-GFP (Sicgen ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-MBP (Aves lab; RRID:AB_2313550), rabbit anti-GFAP (Agilent ...
-
bioRxiv - Cell Biology 2022Quote: ... 1407 Chicken anti-PG (Aves Laboratories); 2G9 Mouse anti-B55α (Cell Signaling Technology) ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken polyclonal anti-GFP (Aves Lab, GFP-1020 ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Tau (1:100; Aves Labs), and anti-Beta tubulin III (Tuj1 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-GFP (Aves Labs, #GFP-1020); anti-NM-IIB αCT (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-GFP (Aves Lab, GFP-1020), anti-KRT14 (Covance ...
-
bioRxiv - Cell Biology 2024Quote: ... anti-GFP (Aves Labs GFP-1020) at 1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies (rabbit anti-cFos, Cell Signaling Technology, 1:500; chicken anti-GFP, Aves Labs, 1:1500) diluted in blocking buffer were added to sections overnight at room temp ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (Aves Lab, GFP-1010), 1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Biophysics 2021Quote: ... Chicken anti-GFP (GFP-1010, Aves Labs); Mouse anti-GFP (2A3 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken anti-GFP (Aves labs, GFP-1020), chicken anti-beta-Galactosidase (abcam ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
bioRxiv - Developmental Biology 2020Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-GFP (Aves Labs, GFP-1010, chicken).