Labshake search
Citations for Aves Labs :
101 - 150 of 510 citations for Human IgM Anti Dengue Virus NS1 Serotype 1 Antibody OB4 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2019Quote: ... The slices were then treated overnight at 4°C with chicken anti-GFP antibody (1:2000) (Aves Labs, Inc., Davis, CA). Then the slices were washed in PBS and treated with Alexa 488 conjugated goat anti-chicken IgY antibody (1:400 ...
-
bioRxiv - Neuroscience 2020Quote: ... and incubated with primary antibody at 4°C for 48 hours: anti-GFP (1:3000, chicken polyclonal, Aves Labs, GFP-1020), anti-DsRed (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... Visualization of ReaChR-mCitrine was enhanced using a chicken polyclonal anti-GFP antibody diluted 1:1000 that also recognizes mCitrine (GFP-1020, AVES labs). Anti-PKCa antibody diluted 1:1000 (ab32376 ...
-
bioRxiv - Neuroscience 2023Quote: ... Dopaminergic neuronal elements were detected with chicken anti-TH antibodies (AB_10013440, Aves Laboratories, Davis, CA, USA; 1:1,000; 48h; 4 °C) (49 ...
-
Dopaminoceptive D1 and D2 neurons in ventral hippocampus arbitrate approach and avoidance in anxietybioRxiv - Neuroscience 2023Quote: ... Native GFP signals in D1- or D2-Cre x fl/fleGFP::L10a mice were enhanced by immunohistochemistry using an anti-GFP primary antibody (chicken; 1:500; #GFP-1020, Aves Labs). Sections were finally incubated with secondary antibodies (donkey anti-chicken Alexa-488-conjugated (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... Tissue was incubated overnight with gentle agitation at 4°C with a chicken polyclonal anti-GFP antibody (1:2000, Aves Labs) in blocking solution ...
-
bioRxiv - Developmental Biology 2019Quote: ... 1:1000 α-GFP antibody (Aves Labs AB_2307313) in antibody binding buffer at 4ºC ...
-
bioRxiv - Neuroscience 2020Quote: ... Primary antibodies were the following: chicken anti-GFP (Aves Labs), rabbit anti-Synaptoporin (Synaptic Systems ...
-
bioRxiv - Neuroscience 2020Quote: ... Primary antibodies were anti-GFP (Aves labs, Chicken, GFP-1020), anti-RFP (Rockland ...
-
bioRxiv - Neuroscience 2019Quote: Anti-GFP antibody (Aves Labs, Cat# GFP-1020, RRID: AB_10000240) was raised against recombinant EGFP in chickens ...
-
bioRxiv - Developmental Biology 2021Quote: ... Primary antibodies: chicken anti-GFP (Aves Lab, cat# GFP-1010) 1:5000 ...
-
bioRxiv - Genetics 2023Quote: The primary antibodies were chicken polyclonal anti-GFP (Aves Labs, catalogue number GFP- 1010 ...
-
bioRxiv - Neuroscience 2024Quote: ... and chicken polyclonal anti-GFP antibody (Aves Labs, Tigard, OR).
-
bioRxiv - Neuroscience 2023Quote: ... cells were treated with primary antibodies: anti-GFP (Aves lab) or anti-FMRP (Abcam ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Tau (1:100; Aves Labs), and anti-Beta tubulin III (Tuj1 ...
-
bioRxiv - Neuroscience 2019Quote: The following primary antibodies were used for either immunoblots (IB) or immunohistochemistry (IHC) experiments: chicken anti-GFP (1:1,000, Aves Labs, GFP-1010), rabbit polyclonal anti-MOR (1:350 ...
-
bioRxiv - Neuroscience 2020Quote: ... Sections were incubated overnight at 4 °C with primary antibodies chicken anti-GFP (1:1,000, AVES Labs, Cat# GFP-1020, RRID: AB_10000240) and rabbit anti-PCP4 (1:200 ...
-
bioRxiv - Neuroscience 2022Quote: ... sections were immunostained for GFP using chicken anti-GFP polyclonal antibody (1:1000, Cat # GFP-1020, RRID:AB_10000240, Aves Labs, Inc., OR, U.S.A.). Slices were washed in PBS 6 × 10 min each ...
-
bioRxiv - Neuroscience 2023Quote: ... and for tyrosine hydroxylase (TH) with a chicken polyclonal anti-TH antibody (E.C. 1.14.16.2, Aves Labs, 1:200 dilution in blocking buffer) overnight at 4°C ...
-
bioRxiv - Neuroscience 2024Quote: ... and washed with PBS for detection of the Slack expression immunostaining with the primary antibody anti-Slack (1:500, Aves labs: custom) and secondary antibody Alexa-Fluor 488 anti-chicken (1:500 ...
-
bioRxiv - Neuroscience 2024Quote: ... Samples were then incubated ON at 4°C with a dilution of 1/2,000 anti-GFP chicken antibody (Aves Lab; GFP-1020), or a dilution of 1/1,000 anti-turboGFP chicken antibody (Origene ...
-
bioRxiv - Developmental Biology 2022Quote: ... For immunohistochemistry, rabbit polyclonal antibody to RFP (1:1000, MBL, PM005) and chicken antibody to GFP (1:250, Aves Labs, GFP-1020) were used ...
-
bioRxiv - Developmental Biology 2021Quote: ... Chicken anti-GFP Antibody (Aves Labs, Davis, CA, Cat #GFP-1020). Rhodamin phalloidin (ThermoFisher Scientific ...
-
bioRxiv - Cell Biology 2022Quote: ... and incubated with anti-GFP antibody (Aves lab, cat# GFP-1010) diluted 1:100 in the blocking solution overnight at 4°C ...
-
bioRxiv - Developmental Biology 2022Quote: ... sections were incubated in primary antibody (chicken anti-GFP, Aves labs GFP-1010 ...
-
bioRxiv - Cancer Biology 2020Quote: ... Primary antibodies: GFP (1:1,000; GFP-1020, Aves Labs), BrdU (1:500 ...
-
bioRxiv - Molecular Biology 2021Quote: ... The cells were washed twice in 1x PBS and hybridized in the aforementioned hybridization buffer containing 1:1000 diluted anti-GFP antibody (Aves labs GFP-1010) for 4 hours at 37°C ...
-
Pancreatic progenitor epigenome maps prioritize type 2 diabetes risk genes with roles in developmentbioRxiv - Genomics 2020Quote: Zebrafish larvae were fixed and stained according to published protocols (Lancman et al., 2013) using the following antibodies: chicken anti-GFP (1:200; Aves Labs; GFP-1020), guinea pig anti-insulin (1:200 ...
-
bioRxiv - Neuroscience 2021Quote: ... Animals were washed in phosphate buffer and incubated overnight at 4°C in primary chicken anti-GFP antibody (1:2000, Aves labs, GFP-1010) or mouse anti-Znp-1 (1:200 ...
-
bioRxiv - Neuroscience 2023Quote: ... Sections were then washed 3 times in PBS for 15 min and incubated in 3% serum blocking solution containing chicken anti-GFP polyclonal antibody (1:2000; Aves Labs, Davis, CA) with gentle agitation at 4℃ overnight ...
-
bioRxiv - Neuroscience 2023Quote: ... or the PDE11A4-specific antibody PDE11A#1-8113A (1:10,000, chicken, Aves Labs custom). All segment blots were probed with the PDE11A#1-8113A antibody only ...
-
bioRxiv - Cell Biology 2020Quote: ... chicken anti-GFP (GFP-1020, Aves Labs; ExM, 1: 1:250), mouse anti-centrin 1 (clone 20H5 ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...