Labshake search
Citations for Aves Labs :
1 - 50 of 159 citations for Chloroethane D5 98% 1000 Ug Ml In Methanol since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... Immunofluorescent staining was performed using primary antibodies (FOS, #2250, Cell Signaling Technology, 1:1000; GFP, GFP1020, Aves Laboratories, 1:1000; dsRed, 632496, Takara, 1:1000), antibodies were reacted with species-specific Alexa Fluor-488 ...
-
bioRxiv - Physiology 2021Quote: ... GFP (1:1000, #1020, Aves Laboratories) and DSRed (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... ɑ-Tau (1:1000, Aves Labs, TAU), mouse ɑ-Myc (1:100 ...
-
bioRxiv - Cell Biology 2020Quote: ... GFP (Aves Labs Inc, 1:1000), goat anti-mouse ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... GFP (1:1000, Aves Lab GFP-1020), Ki67 (1:300 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
bioRxiv - Developmental Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... Chick anti-GFP (1:1000, Aves Lab), or Rabbit anti-GAPDH (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... Sections were then incubated with primary antibodies (chicken anti-GFP Aves Lab 1:1000, rabbit anti-dsRed Abcam 1:1000) that were diluted in the Blocking buffer (1%BSA ...
-
bioRxiv - Cell Biology 2020Quote: ... anti GFP at 1:1000 (Aves Labs #GFP1020), anti GFP at 1:1000 (Life Technologies #A6455) ...
-
bioRxiv - Neuroscience 2020Quote: ... anti-GFP (IF 1:1000, GFP1011, Aves labs), anti-FMRP (IF 1:300 ...
-
bioRxiv - Cell Biology 2019Quote: ... anti-GFP (1:1000 Aves Lab, GFP-1020); anti-H3K9me2 (1:750 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken polyclonal anti-GFP (1:1000, Aves Labs) and for visualization ...
-
bioRxiv - Developmental Biology 2019Quote: ... 1:1000 α-GFP antibody (Aves Labs AB_2307313) in antibody binding buffer at 4ºC ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000), Rabbit anti-PSD95 (Cell Signaling ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000) and Rabbit anti-VMAT2 (Proteintech ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NSE (Aves lab, NSE, 1:1000), Rabbit anti-VGlut1 (Synaptic Systems ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-CD11b (Aves lab, MAC, 1:1000), Mouse anti-NG2 (Santa Cruz ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves labs, GFP-1020,1:1000), goat anti-ChAT (Millipore ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000; Aves Labs #1020) and/or mouseIgG2A anti-ChR2 (1:200 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves Labs, 1020, 1:1000), rabbit anti-Sox2 (GeneTex ...
-
bioRxiv - Genomics 2019Quote: ... and α-GFP 1:1000 (Aves Labs #1020), α-Oct4 1:500 (Santa Cruz #5279) ...
-
bioRxiv - Bioengineering 2023Quote: ... chicken anti-GFP (1:1000, Aves Labs, #1020), rabbit anti-TagRFP (for detection of mRuby2 ...
-
bioRxiv - Neuroscience 2023Quote: ... Anti-GFP (1:1000, Aves Labs, Cat#: 1020), Anti-parvalbumin (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... chicken anti-GFP (1:1000, Aves Lab #1020), guinea-pig antiparvalbumin (1:2000 ...
-
bioRxiv - Neuroscience 2022Quote: ... The following primary antibodies were used: GFP (1:1000, #GFP-1020) and Nestin (1:1000, #Nes) from Aves Laboratories (Tigard, USA); FGFR1 (1:200 ...
-
bioRxiv - Developmental Biology 2021Quote: ... anti-GFP (Chicken 1:1000; Aves Lab; GFP-1020), anti-insulin (Rabbit 1:300 ...
-
bioRxiv - Neuroscience 2021Quote: ... chick anti-tyrosine hydroxylase (1:1000, TYH; Aves Laboratories), rabbit anti-calretinin (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... A chicken anti-GFP antibody (1:1000, Aves Labs) was used in embryos expressing GFP::Wireless to amplify the signal in fixed embryos ...
-
bioRxiv - Neuroscience 2021Quote: ... Neurofilament-H (NFH, 1:1000 dilution; Aves Labs Inc.), Stathmin (11157-1-AP ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:1000; GFP-1020, Aves Lab), Rabbit anti-NeuN (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Lab, GFP-1020), rabbit anti-Nestin (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... Chicken anti-MAP2 (AVES labs MAP; IF 1:1000), Rabbit anti-Ubiquitin [EPR8830] (Abcam ab134953) ...
-
bioRxiv - Neuroscience 2022Quote: ... Chicken anti-GFP (Aves Labs AB_2307313; IF 1:1000), Rabbit anti-GFP (Invitrogen A-11122 ...