Labshake search

201 - 250 of 465 citations for Anti INSL3 Antibody since 2019

• Mating disrupts morning anticipation in Drosophila melanogaster females

  Sabrina Riva, et al., bioRxiv - Neuroscience 2022

  Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
• Cortical integration of higher-order thalamic inputs is lineage-dependent

  Matthew J. Buchan, et al., bioRxiv - Neuroscience 2022

  Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
• A novel Wnt pathway orients Par complex-dependent cell polarity

  Shigeki Yoshiura, Fumio Matsuzaki, bioRxiv - Cell Biology 2022

  Quote: ... chicken anti-GFP (Aves labs, GFP-1020), chicken anti-beta-Galactosidase (abcam ...
• McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylation

  Marina Arbi, et al., bioRxiv - Molecular Biology 2022

  Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
• Interactions with presynaptic photoreceptors mediated by the Dpr11 and DIP-γ cell surface proteins control selection and survival of Drosophila amacrine neurons

  Kaushiki P. Menon, et al., bioRxiv - Neuroscience 2019

  Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
• TRESK K⁺ Channel Activity Regulates Trigeminal Nociception and Headache

  Zhaohua Guo, et al., bioRxiv - Neuroscience 2019

  Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
• Discovery of Alstrom syndrome gene as a regulator of centrosome duplication in asymmetrically dividing stem cells in Drosophila

  Cuie Chen, Yukiko M. Yamashita, bioRxiv - Developmental Biology 2019

  Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
• Regulation of perineuronal nets in the adult cortex by the electrical activity of parvalbumin interneurons

  Gabrielle Devienne, et al., bioRxiv - Neuroscience 2019

  Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
• Notch signaling coordinates ommatidial rotation in the Drosophila eye via transcriptional regulation of the EGF-Receptor ligand Argos

  Yildiz Koca, et al., bioRxiv - Developmental Biology 2019

  Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
• Zebrafish follistatin-like 1b regulates cardiac contraction during early development

  Xin-Xin I. Zeng, et al., bioRxiv - Developmental Biology 2020

  Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
• 12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune Diabetes

  Abhishek Kulkarni, et al., bioRxiv - Immunology 2021

  Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
• Homeodomain-less MEIS1 suppresses CUL3-dependent ATOH1 degradation to regulate cerebellar granule cell development

  Tomoo Owa, et al., bioRxiv - Cell Biology 2022

  Quote: ... anti-GFP (Aves Labs, GFP-1010, chicken).
• Aging Fly Cell Atlas Identifies Exhaustive Aging Features at Cellular Resolution

  Tzu-Chiao Lu, et al., bioRxiv - Developmental Biology 2022

  Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...
• Neural correlates of individual odor preference in Drosophila

  Matthew A. Churgin, et al., bioRxiv - Neuroscience 2023

  Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...
• Oligodendrocyte dynamics dictate individual performance outcomes of working memory training in mice

  Takahiro Shimizu, et al., bioRxiv - Neuroscience 2023

  Quote: ... anti-YFP (chicken, Aves labs, 1:1,000), anti-Pdgfra (rabbit ...
• A rapid and bidirectional reporter of neural activity reveals neural correlates of social behaviors in Drosophila

  Moise Bonheur, et al., bioRxiv - Neuroscience 2023

  Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...
• In vivo screening of tumor-hepatocyte interactions identifies Plexin B2 as a gatekeeper of liver metastasis

  Costanza Borrelli, et al., bioRxiv - Cancer Biology 2023

  Quote: ... and anti-GFP (Aves Labs #GFP-1020). Sections were repeatedly washed in PBST and incubated with the following secondary antibodies (1:400 ...
• Neuronal potassium channel activity triggers initiation of mRNA translation through binding of translation regulators

  Taylor J. Malone, et al., bioRxiv - Neuroscience 2024

  Quote: ... anti-Slack 1:5000 (Aves labs: custom), anti-puromycin 1:1000 (Millipore Sigma ...
• Optineurin-facilitated axonal mitochondria delivery promotes neuroprotection and axon regeneration

  Dong Liu, et al., bioRxiv - Neuroscience 2024

  Quote: ... Chick anti-GFP (1:1000, Aves Lab), or Rabbit anti-GAPDH (1:1000 ...
• A new look at the architecture and dynamics of the Hydra nerve net

  Athina Keramidioti, et al., bioRxiv - Neuroscience 2024

  Quote: ... anti-GFP (chicken) 1/500 (Aves Lab).
• Rapid and efficient in vivo astrocyte-to-neuron conversion with regional identity and connectivity?

  Lei-Lei Wang, et al., bioRxiv - Neuroscience 2020

  Quote: ... The following primary antibodies were used: GFP (Chicken; 1:2000; Aves Labs), mCherry (Goat ...
• Frontal cortical regulation of neurogenesis and cellular proliferation in the ventral subventricular zone

  Moawiah M Naffaa, et al., bioRxiv - Neuroscience 2022

  Quote: ... We used primary antibodies to GFP (#GFP-1020, 1:400, AVES lab), Choline Acetyltransferase Antibody (#AB144P ...
• Actomyosin-II Proactively Shields Axons of the Central Nervous System from Mild Mechanical Stress

  Xiaorong Pan, et al., bioRxiv - Neuroscience 2023

  Quote: ... followed by adding primary antibody GFP (1:1000; Aves Labs, #GFP-1020), which was incubated overnight at 4°C ...
• Defining the molecular identity and morphology of glia limitans superficialis astrocytes in mouse and human

  Philip Hasel, et al., bioRxiv - Neuroscience 2023

  Quote: Hemispheres were incubated in primary antibody (Aves lab, GFP-1020, 1:1000) diluted in PTxwH for 1 week at 37 °C with rotation ...
• Characterization of liver-pancreas crosstalk following β-cell loss reveals a role for the molybdenum cofactor in β-cell regeneration

  Christos Karampelias, et al., bioRxiv - Developmental Biology 2024

  Quote: ... Primary antibodies were used against GFP (1:500; Aves Labs GFP-1020), insulin (1:100 ...
• Characterizing and targeting glioblastoma neuron-tumor networks with retrograde tracing

  Svenja K. Tetzlaff, et al., bioRxiv - Cancer Biology 2024

  Quote: ... For immunolabeling primary antibodies for against GFP (catalog # GFP-1020, Aves Labs) and against RFP (catalog # 600-401-379 ...
• Asymmetric Hapln1a drives regionalised cardiac ECM expansion and promotes heart morphogenesis during zebrafish development

  Christopher J Derrick, et al., bioRxiv - Developmental Biology 2019

  Quote: ... The following commercially available primary antibodies were used: αGFP (1:1000 Aves lab), αCT3 (1:100 ...
• Molecular mechanisms controlling the biogenesis of the TGF-β signal Vg1

  P. C. Dave P. Dingal, et al., bioRxiv - Developmental Biology 2023

  Quote: Primary antibodies were used against GFP (1:1000 chicken IgY, Aves Lab, RRID:AB_2307313) and phosphorylated Smad2 (1:1000 rabbit IgG ...
• Mitochondrial fission, integrity and completion of mitophagy require separable functions of Vps13D in Drosophila neurons

  Ryan Insolera, et al., bioRxiv - Cell Biology 2020

  Quote: ... anti GFP at 1:1000 (Aves Labs #GFP1020), anti GFP at 1:1000 (Life Technologies #A6455) ...
• The feedback regulator Nord controls Dpp/BMP signaling via extracellular interaction with Dally in the Drosophila wing

  Takuya Akiyama, et al., bioRxiv - Developmental Biology 2021

  Quote: ... and chicken anti-GFP (GFP-1010, Aves Labs). Can Get Signal Immunostain Solution B (NKB-601 ...
• FUS-ALS mutants alter FMRP phase separation equilibrium and impair protein translation

  N. Birsa, et al., bioRxiv - Neuroscience 2020

  Quote: ... anti-GFP (IF 1:1000, GFP1011, Aves labs), anti-FMRP (IF 1:300 ...
• Single-cell analysis of the ventricular-subventricular zone reveals signatures of dorsal and ventral adult neurogenic lineages

  Stephanie A. Redmond, et al., bioRxiv - Neuroscience 2021

  Quote: ... Chicken anti-GFP (Aves labs, GFP1020, 1:400), Rabbit anti-HOPX (Proteintech,11419-1-AP,1:500)(Supplementary Table 5) ...
• Arp2/3 and Unc45 maintain heterochromatin stability in Drosophila polytene chromosomes

  George Dialynas, Laetitia Delabaere, Irene Chiolo, bioRxiv - Cell Biology 2019

  Quote: ... anti-GFP (1:1000 Aves Lab, GFP-1020); anti-H3K9me2 (1:750 ...
• Neuropilin 2 signaling mediates corticostriatal transmission, spine maintenance, and goal-directed learning in mice

  Maxime Assous, et al., bioRxiv - Neuroscience 2019

  Quote: ... chicken polyclonal anti-GFP (1:1000, Aves Labs) and for visualization ...
• Sensory Neurons Innervate Peripheral Lymph Nodes and Locally Regulate Gene Expression in Postsynaptic Endothelium, Stromal Cells, and Innate Leukocytes

  Siyi Huang, et al., bioRxiv - Immunology 2019

  Quote: ... chicken anti-NF200 (Aves Labs, NFH, 1:500), rabbit anti-Tyrosine Hydroxylase (Millipore ...
• Selective axonal translation of prenylated Cdc42 mRNA isoform supports axon growth

  Seung Joon Lee, et al., bioRxiv - Neuroscience 2020

  Quote: ... and chicken anti-NF (1:1,000, Aves labs) was used for primary antibodies and FITC-conjugated donkey anti-Rabbit (1:200 ...
• Therapeutic Reversal of Chemically Induced Parkinson Disease by Converting Astrocytes into Nigral Neurons

  Hao Qian, et al., bioRxiv - Neuroscience 2020

  Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000), Rabbit anti-PSD95 (Cell Signaling ...
• Therapeutic Reversal of Chemically Induced Parkinson Disease by Converting Astrocytes into Nigral Neurons

  Hao Qian, et al., bioRxiv - Neuroscience 2020

  Quote: ... Chicken anti-GFAP (Aves lab, GFAP, 1:100), Rabbit anti-ALDH1L1 (EnCor Biotechnology ...
• Therapeutic Reversal of Chemically Induced Parkinson Disease by Converting Astrocytes into Nigral Neurons

  Hao Qian, et al., bioRxiv - Neuroscience 2020

  Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000) and Rabbit anti-VMAT2 (Proteintech ...
• Therapeutic Reversal of Chemically Induced Parkinson Disease by Converting Astrocytes into Nigral Neurons

  Hao Qian, et al., bioRxiv - Neuroscience 2020

  Quote: ... Chicken anti-NSE (Aves lab, NSE, 1:1000), Rabbit anti-VGlut1 (Synaptic Systems ...
• Therapeutic Reversal of Chemically Induced Parkinson Disease by Converting Astrocytes into Nigral Neurons

  Hao Qian, et al., bioRxiv - Neuroscience 2020

  Quote: ... Chicken anti-CD11b (Aves lab, MAC, 1:1000), Mouse anti-NG2 (Santa Cruz ...
• An executive center for the intake of liquids

  Bowen Dempsey, et al., bioRxiv - Neuroscience 2021

  Quote: ... chicken anti-GFP (Aves labs, GFP-1020,1:1000), goat anti-ChAT (Millipore ...
• Epidermal Stratification Requires Retromer-Mediated Desmoglein-1 Recycling

  Marihan Hegazy, et al., bioRxiv - Cell Biology 2021

  Quote: ... chicken anti-plakoglobin (1407 and 1408 - Aves Laboratories), mouse anti-EEA1 (BD Bioscience cat# 610456 ...
• The organization and developmental establishment of cortical interneuron presynaptic circuits

  Gabrielle Pouchelon, et al., bioRxiv - Neuroscience 2020

  Quote: ... chicken anti-GFP (1:1,000; Aves Labs #1020), rabbit anti-somatostatin (1:3,000 ...
• CDC50A dependent phosphatidylserine exposure induces inhibitory post-synapse elimination by microglia

  Jungjoo Park, et al., bioRxiv - Neuroscience 2020

  Quote: ... anti-β-galactosidase (chicken polyclonal from Aves Labs), anti-GAD67 (mouse monoclonal from Merck) ...
• Complement facilitates developmental microglial pruning of astrocyte and vascular networks

  Gopalan Gnanaguru, et al., bioRxiv - Developmental Biology 2022

  Quote: ... anti-chicken GFAP (Aves Labs, Inc, Davis, CA), rabbit anti-P2ry12 (a gift from Dr.Butovsky ...
• Growth cone macropinocytosis of neurotrophin receptor and neuritogenesis are regulated by Neuron Navigator 1

  Regina M. Powers, et al., bioRxiv - Neuroscience 2022

  Quote: ... anti-GFP (5mg/Ml; Aves Lab GFP-1010); and anti-Tbr1 (1:500 ...
• Bottom-up inputs are required for the establishment of top-down connectivity onto cortical layer 1 neurogliaform cells

  Leena A Ibrahim, et al., bioRxiv - Neuroscience 2021

  Quote: ... chicken anti-GFP (1:1000; Aves Labs #1020) and/or mouseIgG2A anti-ChR2 (1:200 ...
• Regulation of NMDA receptor trafficking and gating by activity-dependent CaMKIIα phosphorylation of the GluN2A subunit

  Xuan Ling Hilary Yong, et al., bioRxiv - Neuroscience 2021

  Quote: ... chicken anti-GFP (Cat# GFP-1020, Aves Labs); rabbit anti-GFP (Cat# 50430-2-AP ...
• Myostatin is a negative regulator of adult neurogenesis in zebrafish

  Vishnu Muraleedharan Saraswathy, et al., bioRxiv - Neuroscience 2021

  Quote: ... chicken anti-GFP (Aves Labs, 1020, 1:1000), rabbit anti-Sox2 (GeneTex ...