Labshake search
Citations for Aves Labs :
1 - 50 of 411 citations for 7 Decyn 1 ol since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2024Quote: ... and immunostaining occurred over 7 days with anti-GFP primary antibody (Aves Labs, GFP-1010), and Cy3 donkey anti-Chicken IgG (Jackson ImmunoResearch Labs ...
-
bioRxiv - Neuroscience 2019Quote: ... TH (1:200, Aves Labs, TYH; 1:400, Millipore Sigma, AB152), BIII-Tubulin (1:400 ...
-
bioRxiv - Cell Biology 2020Quote: ... chicken anti-GFP (GFP-1020, Aves Labs; ExM, 1: 1:250), mouse anti-centrin 1 (clone 20H5 ...
-
bioRxiv - Neuroscience 2019Quote: ... GFP (1:1000, Invitrogen, A11122, 1:500, Aves Labs, GFP-1020), TMEM119 (1:1000 ...
-
bioRxiv - Microbiology 2023Quote: ... slides were first stained with 1:200 Mouse monoclonal LAMP-1 (DSHB) and 1:1000 Chicken anti-Salmonella (Aves Labs) for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2019Quote: ... BIII-Tubulin (1:400, Millipore Sigma, T2200; 1:200, Aves Labs, TUJ), NPY (1:200 ...
-
bioRxiv - Neuroscience 2019Quote: ... anti-GFP (rat, 04404-84, Nacalai Tesque, 1:500; rabbit, 598, MBL, 1:500; chick, GFP-1020, Aves Labs, 1:500). After washes ...
-
bioRxiv - Neuroscience 2024Quote: ... Sections were incubated with primary antibodies (IMPDH2, Abcam ab129165, 1:1000; CD68, Bio Rad MCA1957, 1:250; NEUN, Millipore MAB377, 1:2000; GFAP, Aves Lab 75-240 ...
-
bioRxiv - Neuroscience 2020Quote: ... GFP (1:2000, goat directly conjugated to FITC, Abcam; 1:10000, chicken, Aves Labs), PDGFRβ (1:200 ...
-
bioRxiv - Neuroscience 2023Quote: ... or the PDE11A4-specific antibody PDE11A#1-8113A (1:10,000, chicken, Aves Labs custom). All segment blots were probed with the PDE11A#1-8113A antibody only ...
-
bioRxiv - Cell Biology 2024Quote: ... chicken anti-GFP (Aves Lab, GFP-1020; 1:500 to 1:1000 for ICC), mouse anti-GFP (Roche ...
-
bioRxiv - Neuroscience 2021Quote: ... GFAP (1:1,000, Aves Labs) and GFP (1:500 ...
-
bioRxiv - Neuroscience 2024Quote: ... chicken anti-neurofilament heavy chain (NFH) (Abcam, ab4680, 1:50 or Aves Labs, 1:50), rabbit anti-DsRed (Takara ...
-
bioRxiv - Neuroscience 2022Quote: ... Immunofluorescent staining was performed using primary antibodies (FOS, #2250, Cell Signaling Technology, 1:1000; GFP, GFP1020, Aves Laboratories, 1:1000; dsRed, 632496, Takara, 1:1000), antibodies were reacted with species-specific Alexa Fluor-488 ...
-
bioRxiv - Neuroscience 2021Quote: ... slices were counterstained with Hoechst (1:800) and chicken polyclonal anti-GFP (Aves Labs, 1:800), and the nylon inserts were mounted onto glass slides using Fluormount-G (Southern Biotech) ...
-
bioRxiv - Physiology 2021Quote: ... GFP (1:1000, #1020, Aves Laboratories) and DSRed (1:1000 ...
-
bioRxiv - Neuroscience 2021Quote: ... α-GFP (1:1500, Aves Labs, RRID:AB_10000240), α-Cleaved Caspase-3 (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... ɑ-Tau (1:1000, Aves Labs, TAU), mouse ɑ-Myc (1:100 ...
-
bioRxiv - Cell Biology 2020Quote: ... GFP (Aves Labs Inc, 1:1000), goat anti-mouse ...
-
bioRxiv - Neuroscience 2022Quote: ... GFAP (#GFAP, 1:500, Aves Labs). In brief ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Tau (1:100; Aves Labs), and anti-Beta tubulin III (Tuj1 ...
-
bioRxiv - Neuroscience 2024Quote: ... α-P0 (Aves Lab PZO, 1:2000), α-ERK1/2 (Cell Signaling #9102 ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies (rabbit anti-cFos, Cell Signaling Technology, 1:500; chicken anti-GFP, Aves Labs, 1:1500) diluted in blocking buffer were added to sections overnight at room temp ...
-
bioRxiv - Cell Biology 2020Quote: ... Lamin A/C (MANLAC1, Wolfson Centre for Inherited Neuromuscular Disease, 1:100),33 GFP (Aves labs, 1:2000), the actin-binding domain of nesprin-2s22 generously provided by Greg G ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies specific to TH (Rabbit 1:1000, Thermo Fisher Scientific, #P40101150; Chicken 1:500, Aves Labs, TYH), GFP (Chicken 1:500 ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Cell Biology 2021Quote: ... α-GFP (1:300, Aves Labs, GFP-1020), α-dsRed (1:300 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2020Quote: ... GFP (1:500, chicken, Aves Labs, AB_10000240), Iba1 (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Developmental Biology 2019Quote: ... GFP (1:1000, Aves Lab GFP-1020), Ki67 (1:300 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
A Polybasic Domain in aPKC Mediates Par6-Dependent Control of Membrane Targeting and Kinase ActivitybioRxiv - Cell Biology 2020Quote: ... 1:5,000 (Aves Lab, Cat# GFP-1020), rabbit anti-phospho-mLgl ...
-
bioRxiv - Cell Biology 2021Quote: ... GFP (1:500; Aves Labs GFP-1020) and fibroblasts were fixed in 4% paraformaldehyde (PFA ...