Labshake search
Citations for Aves Labs :
201 - 250 of 462 citations for Ribose Phosphate Pyrophosphokinase 1 PRPS1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2021Quote: ... GFAP (1:1,000, Aves Labs) and GFP (1:500 ...
-
bioRxiv - Neuroscience 2024Quote: ... chicken anti-neurofilament heavy chain (NFH) (Abcam, ab4680, 1:50 or Aves Labs, 1:50), rabbit anti-DsRed (Takara ...
-
bioRxiv - Neuroscience 2022Quote: ... Samples were stained gradually with primary polyclonal chicken-anti-GFP antibody (Aves Labs, GFP-1020) and secondary donkey-anti-chicken-AlexaFluor488 antibody (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2021Quote: For the immunostaining the first antibodies used are the following: Chicken anti-GFP (Aves Labs Cat#GFP-1020 ...
-
bioRxiv - Physiology 2022Quote: ... Slides were then probed with primary antibodies against GFP (Aves Labs – Cat No. GFP-1020), goat anti-chicken – AF-488 secondary (Thermo – Cat ...
-
bioRxiv - Plant Biology 2023Quote: ... AD and BD fusion proteins were detected with a chicken HA epitope antibody (Aves Labs) and a rabbit LexA binding domain antibody (Clontech) ...
-
bioRxiv - Cell Biology 2024Quote: ... and immunostaining occurred over 7 days with anti-GFP primary antibody (Aves Labs, GFP-1010), and Cy3 donkey anti-Chicken IgG (Jackson ImmunoResearch Labs ...
-
bioRxiv - Neuroscience 2021Quote: ... slices were counterstained with Hoechst (1:800) and chicken polyclonal anti-GFP (Aves Labs, 1:800), and the nylon inserts were mounted onto glass slides using Fluormount-G (Southern Biotech) ...
-
bioRxiv - Physiology 2021Quote: ... GFP (1:1000, #1020, Aves Laboratories) and DSRed (1:1000 ...
-
bioRxiv - Neuroscience 2021Quote: ... α-GFP (1:1500, Aves Labs, RRID:AB_10000240), α-Cleaved Caspase-3 (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... ɑ-Tau (1:1000, Aves Labs, TAU), mouse ɑ-Myc (1:100 ...
-
bioRxiv - Cell Biology 2020Quote: ... GFP (Aves Labs Inc, 1:1000), goat anti-mouse ...
-
bioRxiv - Neuroscience 2022Quote: ... GFAP (#GFAP, 1:500, Aves Labs). In brief ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Tau (1:100; Aves Labs), and anti-Beta tubulin III (Tuj1 ...
-
bioRxiv - Neuroscience 2024Quote: ... α-P0 (Aves Lab PZO, 1:2000), α-ERK1/2 (Cell Signaling #9102 ...
-
bioRxiv - Neuroscience 2021Quote: ... Brain sections were processed for fluorescent IHC for eYFP (using chicken anti-GFP antibody, Aves Labs) and the sections were then mounted onto gelatin-coated slides for microscopic imaging ...
-
bioRxiv - Cell Biology 2020Quote: ... Affinity-purified chicken anti-WHIMP antibodies were generated against mouse WHIMP amino acids 9-21 (Aves Labs). Other antibodies were rabbit anti-MBP [68] ...
-
bioRxiv - Neuroscience 2023Quote: ... GFP expressing neurons and their projections were visualized by immunohistochemistry with chicken anti-GFP antibody (Aves labs) and anti-chicken Alexa-488 secondary antibody (Invitrogene ...
-
bioRxiv - Neuroscience 2023Quote: ... Sections were simultaneously incubated in primary antibody chicken anti-GFP (GFP-1010, Aves Labs, Davis, CA, USA) diluted 1:500 in blocking buffer overnight at 4 °C ...
-
bioRxiv - Cell Biology 2020Quote: ... Lamin A/C (MANLAC1, Wolfson Centre for Inherited Neuromuscular Disease, 1:100),33 GFP (Aves labs, 1:2000), the actin-binding domain of nesprin-2s22 generously provided by Greg G ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Cancer Biology 2019Quote: ... and anti-eGFP (1:1000, Aves Labs) overnight at 4°C followed by appropriate secondary antibody incubation for 1-2h (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Cell Biology 2021Quote: ... α-GFP (1:300, Aves Labs, GFP-1020), α-dsRed (1:300 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2020Quote: ... GFP (1:500, chicken, Aves Labs, AB_10000240), Iba1 (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Developmental Biology 2019Quote: ... GFP (1:1000, Aves Lab GFP-1020), Ki67 (1:300 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
A Polybasic Domain in aPKC Mediates Par6-Dependent Control of Membrane Targeting and Kinase ActivitybioRxiv - Cell Biology 2020Quote: ... 1:5,000 (Aves Lab, Cat# GFP-1020), rabbit anti-phospho-mLgl ...
-
bioRxiv - Cell Biology 2021Quote: ... GFP (1:500; Aves Labs GFP-1020) and fibroblasts were fixed in 4% paraformaldehyde (PFA ...
-
bioRxiv - Developmental Biology 2020Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Neuroscience 2022Quote: ... and GFP (Aves Labs, 1:2000 dilution) for 48 hours at 4°C ...
-
bioRxiv - Physiology 2022Quote: ... GFP (1:500, Aves Labs, GFP-1020) and TH (1:200 ...
-
bioRxiv - Neuroscience 2022Quote: ... MPZ (Aves Labs, 1:2000, PZO, RRID:AB_2313561), MBP (EMD Millipore ...