Labshake search
Citations for Aves Labs :
201 - 250 of 465 citations for Mouse Anti Streptococcus Pneumoniae Antibody SN4 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken anti-GFP (Aves labs, GFP-1020), chicken anti-beta-Galactosidase (abcam ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
bioRxiv - Developmental Biology 2020Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-GFP (Aves Labs, GFP-1010, chicken).
-
bioRxiv - Developmental Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-YFP (chicken, Aves labs, 1:1,000), anti-Pdgfra (rabbit ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and anti-GFP (Aves Labs #GFP-1020). Sections were repeatedly washed in PBST and incubated with the following secondary antibodies (1:400 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-Slack 1:5000 (Aves labs: custom), anti-puromycin 1:1000 (Millipore Sigma ...
-
bioRxiv - Neuroscience 2024Quote: ... Chick anti-GFP (1:1000, Aves Lab), or Rabbit anti-GAPDH (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-GFP (chicken) 1/500 (Aves Lab).
-
bioRxiv - Neuroscience 2020Quote: ... The following primary antibodies were used: GFP (Chicken; 1:2000; Aves Labs), mCherry (Goat ...
-
bioRxiv - Neuroscience 2022Quote: ... We used primary antibodies to GFP (#GFP-1020, 1:400, AVES lab), Choline Acetyltransferase Antibody (#AB144P ...
-
bioRxiv - Neuroscience 2023Quote: ... followed by adding primary antibody GFP (1:1000; Aves Labs, #GFP-1020), which was incubated overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: Hemispheres were incubated in primary antibody (Aves lab, GFP-1020, 1:1000) diluted in PTxwH for 1 week at 37 °C with rotation ...
-
bioRxiv - Developmental Biology 2024Quote: ... Primary antibodies were used against GFP (1:500; Aves Labs GFP-1020), insulin (1:100 ...
-
bioRxiv - Cancer Biology 2024Quote: ... For immunolabeling primary antibodies for against GFP (catalog # GFP-1020, Aves Labs) and against RFP (catalog # 600-401-379 ...
-
bioRxiv - Developmental Biology 2019Quote: ... The following commercially available primary antibodies were used: αGFP (1:1000 Aves lab), αCT3 (1:100 ...
-
bioRxiv - Developmental Biology 2023Quote: Primary antibodies were used against GFP (1:1000 chicken IgY, Aves Lab, RRID:AB_2307313) and phosphorylated Smad2 (1:1000 rabbit IgG ...
-
bioRxiv - Cell Biology 2020Quote: ... anti GFP at 1:1000 (Aves Labs #GFP1020), anti GFP at 1:1000 (Life Technologies #A6455) ...
-
bioRxiv - Developmental Biology 2021Quote: ... and chicken anti-GFP (GFP-1010, Aves Labs). Can Get Signal Immunostain Solution B (NKB-601 ...
-
bioRxiv - Neuroscience 2020Quote: ... anti-GFP (IF 1:1000, GFP1011, Aves labs), anti-FMRP (IF 1:300 ...
-
bioRxiv - Neuroscience 2021Quote: ... Chicken anti-GFP (Aves labs, GFP1020, 1:400), Rabbit anti-HOPX (Proteintech,11419-1-AP,1:500)(Supplementary Table 5) ...
-
bioRxiv - Cell Biology 2019Quote: ... anti-GFP (1:1000 Aves Lab, GFP-1020); anti-H3K9me2 (1:750 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken polyclonal anti-GFP (1:1000, Aves Labs) and for visualization ...
-
bioRxiv - Immunology 2019Quote: ... chicken anti-NF200 (Aves Labs, NFH, 1:500), rabbit anti-Tyrosine Hydroxylase (Millipore ...
-
bioRxiv - Neuroscience 2020Quote: ... and chicken anti-NF (1:1,000, Aves labs) was used for primary antibodies and FITC-conjugated donkey anti-Rabbit (1:200 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000), Rabbit anti-PSD95 (Cell Signaling ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFAP (Aves lab, GFAP, 1:100), Rabbit anti-ALDH1L1 (EnCor Biotechnology ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000) and Rabbit anti-VMAT2 (Proteintech ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NSE (Aves lab, NSE, 1:1000), Rabbit anti-VGlut1 (Synaptic Systems ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-CD11b (Aves lab, MAC, 1:1000), Mouse anti-NG2 (Santa Cruz ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves labs, GFP-1020,1:1000), goat anti-ChAT (Millipore ...
-
bioRxiv - Cell Biology 2021Quote: ... chicken anti-plakoglobin (1407 and 1408 - Aves Laboratories), mouse anti-EEA1 (BD Bioscience cat# 610456 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1,000; Aves Labs #1020), rabbit anti-somatostatin (1:3,000 ...
-
bioRxiv - Neuroscience 2020Quote: ... anti-β-galactosidase (chicken polyclonal from Aves Labs), anti-GAD67 (mouse monoclonal from Merck) ...
-
bioRxiv - Developmental Biology 2022Quote: ... anti-chicken GFAP (Aves Labs, Inc, Davis, CA), rabbit anti-P2ry12 (a gift from Dr.Butovsky ...