Labshake search
Citations for Aves Labs :
51 - 100 of 442 citations for Human Complement Component 1 Q Subcomponent Binding Protein HABP1 C1QBP ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2020Quote: ... GFP (1:500, chicken, Aves Labs, AB_10000240), Iba1 (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Developmental Biology 2019Quote: ... GFP (1:1000, Aves Lab GFP-1020), Ki67 (1:300 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
A Polybasic Domain in aPKC Mediates Par6-Dependent Control of Membrane Targeting and Kinase ActivitybioRxiv - Cell Biology 2020Quote: ... 1:5,000 (Aves Lab, Cat# GFP-1020), rabbit anti-phospho-mLgl ...
-
bioRxiv - Cell Biology 2021Quote: ... GFP (1:500; Aves Labs GFP-1020) and fibroblasts were fixed in 4% paraformaldehyde (PFA ...
-
bioRxiv - Developmental Biology 2020Quote: ... GFP (anti-Chick, Aves Labs, 1:300), mCherry (anti-Rabbit ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Neuroscience 2022Quote: ... and GFP (Aves Labs, 1:2000 dilution) for 48 hours at 4°C ...
-
bioRxiv - Physiology 2022Quote: ... GFP (1:500, Aves Labs, GFP-1020) and TH (1:200 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-Slack 1:5000 (Aves labs: custom), anti-puromycin 1:1000 (Millipore Sigma ...
-
bioRxiv - Neuroscience 2024Quote: ... Chick anti-GFP (1:1000, Aves Lab), or Rabbit anti-GAPDH (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-GFP (chicken) 1/500 (Aves Lab).
-
bioRxiv - Neuroscience 2022Quote: ... MPZ (Aves Labs, 1:2000, PZO, RRID:AB_2313561), MBP (EMD Millipore ...
-
bioRxiv - Developmental Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-YFP (chicken, Aves labs, 1:1,000), anti-Pdgfra (rabbit ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...
-
bioRxiv - Cell Biology 2024Quote: ... chicken anti-GFP (Aves Labs, 1:100) and mouse anti-mCherry (Clonetech ...
-
bioRxiv - Cell Biology 2024Quote: ... chicken anti-GFP (Aves Labs, 1:500), and insulin (Agilent ...
-
bioRxiv - Physiology 2024Quote: ... anti-chicken GFP (1:5000, Aves Lab) was used followed by AlexaFluor 488-conjugated goat-anti-chicken (1:1000) ...
-
bioRxiv - Neuroscience 2022Quote: ... Sections were then incubated with primary antibodies (chicken anti-GFP Aves Lab 1:1000, rabbit anti-dsRed Abcam 1:1000) that were diluted in the Blocking buffer (1%BSA ...
-
bioRxiv - Cell Biology 2020Quote: ... anti GFP at 1:1000 (Aves Labs #GFP1020), anti GFP at 1:1000 (Life Technologies #A6455) ...
-
bioRxiv - Neuroscience 2020Quote: ... anti-GFP (IF 1:1000, GFP1011, Aves labs), anti-FMRP (IF 1:300 ...
-
bioRxiv - Neuroscience 2021Quote: ... Chicken anti-GFP (Aves labs, GFP1020, 1:400), Rabbit anti-HOPX (Proteintech,11419-1-AP,1:500)(Supplementary Table 5) ...
-
bioRxiv - Cell Biology 2019Quote: ... anti-GFP (1:1000 Aves Lab, GFP-1020); anti-H3K9me2 (1:750 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken polyclonal anti-GFP (1:1000, Aves Labs) and for visualization ...
-
bioRxiv - Immunology 2019Quote: ... chicken anti-NF200 (Aves Labs, NFH, 1:500), rabbit anti-Tyrosine Hydroxylase (Millipore ...
-
bioRxiv - Developmental Biology 2019Quote: ... 1:1000 α-GFP antibody (Aves Labs AB_2307313) in antibody binding buffer at 4ºC ...
-
bioRxiv - Neuroscience 2020Quote: ... and chicken anti-NF (1:1,000, Aves labs) was used for primary antibodies and FITC-conjugated donkey anti-Rabbit (1:200 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000), Rabbit anti-PSD95 (Cell Signaling ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFAP (Aves lab, GFAP, 1:100), Rabbit anti-ALDH1L1 (EnCor Biotechnology ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-TH (Aves lab, TYH, 1:1000) and Rabbit anti-VMAT2 (Proteintech ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NSE (Aves lab, NSE, 1:1000), Rabbit anti-VGlut1 (Synaptic Systems ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-CD11b (Aves lab, MAC, 1:1000), Mouse anti-NG2 (Santa Cruz ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1,000; Aves Labs #1020), rabbit anti-somatostatin (1:3,000 ...
-
bioRxiv - Neuroscience 2022Quote: ... and chicken α-GFP (1:3000, Aves Lab) in 4°C ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000; Aves Labs #1020) and/or mouseIgG2A anti-ChR2 (1:200 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves Labs, 1020, 1:1000), rabbit anti-Sox2 (GeneTex ...
-
bioRxiv - Neuroscience 2020Quote: ... 1:250 (Aves Labs, Cat#MAP, RRID: AB_2313549); Goat polyclonal anti-mCherry ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-NF200 (Aves Labs, NFH877982, 1:500), rabbit anti-HA to detect hM3Dq expression (Cell Signaling Technologies ...