Labshake search
Citations for Sartorius :
101 - 150 of 291 citations for Glutathione S Transferase GST Fluorescent Kit 1 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: Cells were plated in 24 well plates and images were obtained using Incucyte (Sartorius) using whole well imaging at 4X ...
-
bioRxiv - Cancer Biology 2023Quote: ... Plates were transferred into an Incucyte® Live-Cell Analysis System (Sartorius, model S3), and whole well images were collected every 6 hours until wells reached 100% confluence ...
-
bioRxiv - Genetics 2023Quote: A monolayer scratch assay was performed on a 96-well Essen ImageLock plate (Sartorius) using the IncuCyte® WoundMaker Tool (Sartorius ...
-
bioRxiv - Cell Biology 2020Quote: A549 lung cancer cells (4*104) were plated in a 96-well ImageLock plate (Sartorius) and cultured in a 20% O2 ...
-
bioRxiv - Cancer Biology 2020Quote: Approximately 25,000 cells per well were seeded on a Sartorius 96-well LockView plate (Sartorius) the night prior to wound formation ...
-
bioRxiv - Cancer Biology 2021Quote: ... The plate was transferred into the IncuCyte S3 Live-Cell Analysis System (Sartorius, cat #4647) for imaging ...
-
bioRxiv - Cancer Biology 2022Quote: ... The plates were placed inside the IncuCyte S3 live cell imaging system (Sartorius, Goettingen, Germany) incubator (37°C ...
-
bioRxiv - Developmental Biology 2022Quote: hPSC were differentiated into TE on VTN-coated Incucyte ImageLock 96-well plates (4379, Sartorius) according to the TE differentiation protocol described above ...
-
bioRxiv - Cell Biology 2022Quote: ... Plates were imaged every 24 hours on the Incucyte S3 Live-cell analysis system (Sartorius) using brightfield and 10x objective and capturing 16 fields per well ...
-
bioRxiv - Cancer Biology 2022Quote: ... All plates were then compared together by PCA using Simca 16.0 software (Umetrics, Sartorius Stedim Biotech), unit variance scaled and performing a 7-fold cross validation ...
-
bioRxiv - Cancer Biology 2022Quote: ... after which the plates were loaded onto the IncuCyte ZOOM live cell imaging system (Sartorius, 4459). Cell proliferation was monitored via time-lapse image acquisition (2 images per well ...
-
bioRxiv - Cancer Biology 2022Quote: ... The tissue culture plate was incubated for 24 hours before transferring into an IncuCyte S3 (Sartorius) with the same incubation conditions ...
-
bioRxiv - Immunology 2023Quote: ... seeded at 5 × 105 cells/100 μL into Incucyte Imagelock 96-well plates (Sartorius, BA-04857) and incubated for 6 hours ...
-
bioRxiv - Microbiology 2023Quote: Live cell imaging was performed in a 96-well format using an Incucyte plate imager (Sartorius). Images were taken every 2-4 h in the respective channels ...
-
bioRxiv - Microbiology 2023Quote: ... Cultivation was performed in cell culture plates (24 well for suspension cells, Sartorius AG, Göttingen, Germany) in an anaerobic tent (Coy Laboratory ...
-
bioRxiv - Cancer Biology 2021Quote: MDA-MB 231 cells (5.5 x 104) were seeded onto a 96-well imageLock plate (Sartorius, 4379) and grown for 24 h until cell confluency was reached ...
-
bioRxiv - Neuroscience 2022Quote: ... and plated at a density of 10,000 cells /well in Incucyte® Imagelock 96-well Plate (Sartorius) pre-cultured with 20,000 mouse glial cells/well ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were then seeded in 96-well plates in cell growth media containing Annexin V Dye (Sartorius). Cells were imaged by real-time fluorescence microscopy (IncuCyte ...
-
bioRxiv - Cancer Biology 2023Quote: ... The changes in GFP of cells in 12-well plates were monitored by using IncuCyte SX5 (Sartorius) for 72 hrs.
-
bioRxiv - Cancer Biology 2023Quote: ... The plate was then incubated for up to 72hrs post-treatment in the Incucyte S3 (Sartorius, Germany) under the same acquisition parameters as above.
-
bioRxiv - Cell Biology 2024Quote: ... allowed to form monolayers (8h) before removing the insert and moving the plate to IncuCyte S3 (Sartorius) for live cell imaging ...
-
bioRxiv - Immunology 2024Quote: ... Plates were left at room temperature for 20 min and transferred to the Incucyte SX1 instrument (Sartorius) for baseline images ...
-
bioRxiv - Microbiology 2021Quote: ... Plates were then loaded in an IncuCyte S3 high-content imaging system (Essen Bioscience/Sartorius, Ann Arbor, MI). Longitudinal image acquisition and processing for virus-induced cytopathic effect (CPE ...
-
bioRxiv - Cell Biology 2022Quote: ... medium was changed to remove Ri and the plate was placed in Incucyte S3 live imaging system (Sartorius) and imaged every 2 hours for 50 hours using 10x objective taking 16 frames per well ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... plates were scanned with a 10× objective using the Incucyte ZOOM imaging system (Sartorius, Ann Arbor, MI, USA). Normalized GFP expression (GCU ...
-
bioRxiv - Cancer Biology 2022Quote: ... 100 μL PBS per well was added and plates were imaged on an IncuCyte® S3 system (Sartorius). Fluorescence was quantified using the IncuCyte analysis software ...
-
bioRxiv - Cancer Biology 2023Quote: ... 500 cells were plated into each well of an IncuCyte® ImageLock 96-well plate (Sartorius; #BA-04856) and imaged every 30 min for a period of 48 h using a 10X objective ...
-
bioRxiv - Microbiology 2023Quote: ... well plates were imaged hourly in the IncuCyte Zoom HD/2CLR time-lapse microscopy system (Sartorius, Göttingen, Germany) equipped with an IncuCyte Zoom 10× Plan Fluor objective (Sartorius ...
-
bioRxiv - Genetics 2022Quote: ... Bacterial concentration was determined by flow cytometry (Becton Dickinson LSRFortessa) such that 150,000 spirochetes per well of an ImageLock 96-well plate (Sartorius) were incubated with either 8µg/mL or 16µg/mL of variant (TP607036;MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDA PLEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV ...
-
bioRxiv - Cancer Biology 2023Quote: ... cells were seeded in 96 well plate in the presence of 1x Cytotox reagent (cat# ESS4633 or ESS4632; Sartorius), a highly sensitive cyanine nucleic acid dye ...
-
bioRxiv - Cancer Biology 2023Quote: ... 15,000 MDA-MB-231 cells were seeded in 96-well ImageLock plates compatible with the Incucyte Zoom system (Sartorius). 24 hours after seeding a scratch wound was made using the WoundMaker Tool (Sartorius ...
-
bioRxiv - Cancer Biology 2023Quote: ... Timelapse imaging to assess spheroid formation in round bottom ULA plates was performed using IncuCyte S3 imaging system (Sartorius). Cells were seeded in 96 well ULA plates and images every 3 hours for 48 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... The plate was incubated at 37°C and 5% CO2 and imaged using an Incucyte Live-Cell imager (Sartorius). The red channel used an acquisition time of 400 milliseconds for all replicates and samples ...
-
bioRxiv - Cancer Biology 2024Quote: ... Mitochondrial membrane potential kit (Sartorius, 4775) was used for MMP measurements according to the manufacturer instructions ...
-
bioRxiv - Genetics 2021Quote: ... Neuronal migration was measured during a 70-hour period from day 40 by transferring cell culture plates to the IncuCyte Live Cell Analysis System (Sartorius). Cells were maintained at 37°C and 5% CO2 with 20X magnification phase contrast images taken of whole wells in every 2 hours for the analysis period ...
-
bioRxiv - Cancer Biology 2022Quote: ... GFP-NANOG MDA-MB-231 cells were plated on fibronectin-coated (30 μg/mL) glass 96 well plates and placed in an Incucyte S3 (Sartorius) live cell imaging system ...
-
bioRxiv - Cancer Biology 2022Quote: ... Basolateral compartments were filled with culture medium containing 10% FBS and plates were placed in an Incucyte S3 Imaging System (Sartorius). Images of the apical and basolateral sides of the porous membrane were captured every 4 hours over 3 days ...
-
bioRxiv - Cancer Biology 2019Quote: TNBC control and gene knocked down cells (500/well) were seeded in 384 well plate and transferred to Incucyte ZOOM analysis system (Sartorius) that was maintained at 37 °C ...
-
bioRxiv - Developmental Biology 2022Quote: ... cells were grown on a 96-well plate and placed in the incubated chamber of an Incucyte ZOOM Microscope (Sartorius). EpiLC differentiation medium was added and supplemented with 5µM of Caspase 3/7 Green dye (Sartorius ...
-
bioRxiv - Cancer Biology 2022Quote: ... 5 x 104 cells were seeded in each well of an Incucyte® ImageLock 96-well plate (Sartorius, Catalog #: 4379) in 100 μL/well of either complete RPMI or DMEM ...
-
bioRxiv - Cancer Biology 2023Quote: ... 7500 cells per genotype were seeded in 96-well plates in both media conditions and proliferation was monitored via the IncuCyte Zoom imaging platform (Sartorius) for up to 72 hours ...
-
bioRxiv - Immunology 2023Quote: HeLa and MDA-MB-231 WT and ARPC5-KO cells were seeded in a 96-well ImageLock plate (Sartorius #4806) and incubated for 24 h ...
-
bioRxiv - Neuroscience 2023Quote: ... Octet® SAX high precision streptavidin biosensors and Octet® 384TW tilted-bottom plates were purchased from Sartorius (Göttingen, Germany). Peptides were synthesized by GenScript (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: ... Plates of infected macrophages were imaged in triplicate per well in an Incucyte S3 Live-Cell Analysis Platform (Sartorius #4647). Phase and fluorescence images were collected every hour per well using a 20X objective ...
-
bioRxiv - Molecular Biology 2023Quote: ... 3–5 x103 cells were seeded in 96-well plates and viable cell numbers were determined using the Incucyte (Sartorius) Adherent-Cell-by-Cell module ...
-
bioRxiv - Immunology 2024Quote: ... Plates were imaged every 4-6 hours for 3-7 days using the IncuCyte® Live-Cell Analysis System (Sartorius). 5 images per well at 10x zoom were collected at each time point ...
-
bioRxiv - Neuroscience 2024Quote: ... Well plates then immediately underwent imaging with an Incucyte SX5 equipped with a SX5 G/O/NIR optical module (Sartorius). Quantifications were conducted with the systems onboard analysis software.
-
bioRxiv - Cancer Biology 2023Quote: ... 2.5 x 103 cells/well were plated in FBS-free media in the upper chamber of a 96-well Incucyte ClearView cell migration plate (8 µm pore size; #4582 Sartorius). Cells were incubated at 37°C for 45 minutes to allow cells to settle on the membrane before adding RPMI-1640 media supplemented with 10% FBS to the bottom chamber ...
-
bioRxiv - Immunology 2024Quote: ... The mixture was gently resuspended for 60 sec and 50 µl were added in a 96 well image lock plate (Sartorius) on ice ...
-
The Kinase Chemogenomic Set (KCGS): An open science resource for kinase vulnerability identificationbioRxiv - Cell Biology 2019Quote: ... 50 µl media with 2 x compound concentration was added and plates were subsequently placed and monitored in an IncuCyte® (Sartorius) instrument ...